PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ciclev10005747m

Common Name

CICLE_v10005747mg

Organism

Citrus clementina

Taxonomic ID

85681

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

ARR-B

Protein Properties

Length: 242aa MW: 27744.1 Da PI: 6.7835

Description

ARR-B family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10005747m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	74.8	1.2e-23	178	228	1	52
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 kpr+ W+ eLH++Fv+av L G++kA+Pk+ilelm+v+gLt+e+v+SHLQ Ciclev10005747m 178 KPRVFWSVELHQQFVSAVIWL-GIDKAVPKKILELMNVPGLTRENVASHLQV 228 79*****************.***************************5 PP
2	Response_reg	72.6	1.5e-24	20	128	1	109
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 vl+vdD+p+ +++l+++l+k y ev+ + +e al++l+ ++ +D+++ D+ mp+mdG++l ++ e +lp+i+++ g +d+ + + Ciclev10005747m 20 VLVVDDDPIWLRILEKMLRKCLY-EVTKCNRAEIALDMLRMSKngYDIVISDVHMPDMDGFKLHEQVGLEM-DLPVIMMSVDGCTQDVMKGVTH 111 89*******************.***********888888******************6644.8***************** PP TESEEEESS--HHHHHH CS Response_reg 93 GakdflsKpfdpeelvk 109 Ga +l Kp+ ++el++ Ciclev10005747m 112 GACNYLLKPIRIKELRN 128 ************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF036392	1.8E-121	1	231	IPR017053	Response regulator B-type, plant
SuperFamily	SSF52172	1.57E-32	17	142	IPR011006	CheY-like superfamily
Gene3D	G3DSA:3.40.50.2300	7.6E-40	17	159	No hit	No description
SMART	SM00448	8.1E-25	18	130	IPR001789	Signal transduction response regulator, receiver domain
PROSITE profile	PS50110	39.181	19	134	IPR001789	Signal transduction response regulator, receiver domain
Pfam	PF00072	5.9E-22	20	129	IPR001789	Signal transduction response regulator, receiver domain
CDD	cd00156	1.24E-24	21	134	No hit	No description
PROSITE profile	PS51294	10.345	175	234	IPR017930	Myb domain
SuperFamily	SSF46689	3.4E-16	175	231	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	5.0E-23	177	227	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.8E-21	178	230	IPR006447	Myb domain, plants

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 242 aa Download sequence Send to blast
MSPASSSVAV SDQFPAGLRV LVVDDDPIWL RILEKMLRKC LYEVTKCNRA EIALDMLRMS 60 KNGYDIVISD VHMPDMDGFK LHEQVGLEMD LPVIMMSVDG CTQDVMKGVT HGACNYLLKP 120 IRIKELRNIW QHVAQQPKPF EESDDSYSVN QGNWRTSNRR KDEEEEAEKR DDTSTLKKPR 180 VFWSVELHQQ FVSAVIWLGI DKAVPKKILE LMNVPGLTRE NVASHLQVLY KTLELRKFCR 240 I*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	7e-18	177	227	4	54	ARR10-B
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in pollen. {ECO:0000269\|PubMed:11370868, ECO:0000269\|PubMed:15173562, ECO:0000269\|PubMed:9891419}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269\|PubMed:11370868, ECO:0000269\|PubMed:11574878, ECO:0000269\|PubMed:15282545, ECO:0000269\|PubMed:16407152}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024047531.1	1e-134	two-component response regulator ARR2
Swissprot	Q9ZWJ9	5e-99	ARR2_ARATH; Two-component response regulator ARR2
TrEMBL	V4S729	1e-179	V4S729_9ROSI; Uncharacterized protein
STRING	XP_006419446.1	1e-180	(Citrus clementina)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G16110.1	1e-93	response regulator 2

Link Out ? help Back to Top
Phytozome	Ciclev10005747m
Entrez Gene	18031319

Publications ? help Back to Top
Takahashi N, et al. Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots. Curr. Biol., 2013. 23(18): p. 1812-7 [PMID:24035544] Ge XM, et al. Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis. Plant J., 2015. 82(1): p. 138-50 [PMID:25704455] Takahashi N,Umeda M Cytokinins promote onset of endoreplication by controlling cell cycle machinery. Plant Signal Behav, 2014. 9(8): p. e29396 [PMID:25763620] Kobayashi K, et al. Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling. Plant Physiol., 2017. 173(4): p. 2340-2355 [PMID:28193764] Arnaud D, et al. Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis. Plant Cell, 2017. 29(3): p. 543-559 [PMID:28254779] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Takatsuka H,Higaki T,Umeda M Actin Reorganization Triggers Rapid Cell Elongation in Roots. Plant Physiol., 2018. 178(3): p. 1130-1141 [PMID:30185441]