PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_46239 | ||||||||
Common Name | KK1_049115 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 69aa MW: 7987.18 Da PI: 5.4552 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 40.4 | 5.4e-13 | 5 | 62 | 41 | 98 |
TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 41 esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 + + W vk+ + ++ + +++ GW +F+++n+L+ gD+++F+l++ +++ l ++vfr C.cajan_46239 5 FRKNLWPVKFAFHSSGVSGMFSVGWHSFARENELQIGDVCIFELVNGEDGILDLHVFR 62 56788*****9999999999************************98899999999998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 12.717 | 1 | 64 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 9.02E-13 | 6 | 62 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 1.0E-12 | 6 | 65 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 1.6E-10 | 7 | 62 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 5.01E-12 | 8 | 62 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 69 aa Download sequence Send to blast |
MMIQFRKNLW PVKFAFHSSG VSGMFSVGWH SFARENELQI GDVCIFELVN GEDGILDLHV 60 FRDQCEVMH |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_46239 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020209298.1 | 5e-43 | B3 domain-containing transcription factor VRN1 isoform X1 | ||||
Refseq | XP_020209299.1 | 5e-43 | B3 domain-containing transcription factor VRN1 isoform X2 | ||||
TrEMBL | A0A151UI03 | 7e-44 | A0A151UI03_CAJCA; B3 domain-containing transcription factor VRN1 | ||||
STRING | GLYMA09G20150.1 | 1e-21 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF98 | 34 | 369 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G18990.1 | 1e-10 | B3 family protein |