PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_36997 | ||||||||
Common Name | KK1_037847 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 78aa MW: 9304.68 Da PI: 4.7048 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 70.7 | 3.8e-22 | 8 | 67 | 2 | 63 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFsk 63 +pGfrFhPtdeelv++yLk+k+++k+l++ e ik+vdiyk++PwdLp+k +++++ +fF + C.cajan_36997 8 MPGFRFHPTDEELVDFYLKRKIQQKSLPI-ELIKQVDIYKYDPWDLPSK-NSSDSYSFFFLP 67 79***************************.89***************44.456778899975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 21.487 | 7 | 78 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.02E-21 | 7 | 67 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.8E-10 | 9 | 67 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MEKIEDVMPG FRFHPTDEEL VDFYLKRKIQ QKSLPIELIK QVDIYKYDPW DLPSKNSSDS 60 YSFFFLPFSS FAVLLYAT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 7e-17 | 6 | 65 | 14 | 73 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_36997 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015044 | 1e-76 | AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020201927.1 | 1e-30 | protein FEZ | ||||
Refseq | XP_020201928.1 | 1e-30 | protein FEZ | ||||
Swissprot | Q9FIW5 | 3e-23 | NAC94_ARATH; Putative NAC domain-containing protein 94 | ||||
TrEMBL | A0A151RE44 | 3e-49 | A0A151RE44_CAJCA; Putative NAC domain-containing protein 94 | ||||
STRING | XP_007151225.1 | 1e-29 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF11433 | 17 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G39820.1 | 3e-26 | NAC domain containing protein 94 |