PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_35697 | ||||||||
Common Name | KK1_034612 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 132aa MW: 14545.3 Da PI: 7.5048 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 138.3 | 2e-43 | 1 | 78 | 17 | 94 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 mkk+lP n+ki+kdaketvqe vsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+ylk yr+ + C.cajan_35697 1 MKKALPPNGKIAKDAKETVQEGVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLKTYRDGD 78 9**************************************************************************865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 7.5E-20 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 9.72E-30 | 1 | 90 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 9.2E-40 | 1 | 89 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 5.5E-19 | 19 | 37 | No hit | No description |
PRINTS | PR00615 | 5.5E-19 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 5.5E-19 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MKKALPPNGK IAKDAKETVQ EGVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF 60 EDYIDPLKIY LKTYRDGDSK GSAKGGDVSG RKEVYPSTNA QLAHQGSFSQ GVNYTNSQPQ 120 AQHMIVPMQG QE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 4e-36 | 1 | 76 | 18 | 93 | NF-YB |
4awl_B | 4e-36 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 4e-36 | 1 | 76 | 19 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_35697 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015041 | 7e-42 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027364964.1 | 4e-82 | nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
Swissprot | Q8VYK4 | 2e-58 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A151RMZ9 | 2e-94 | A0A151RMZ9_CAJCA; Nuclear transcription factor Y subunit B-8 | ||||
STRING | XP_007144526.1 | 8e-80 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2545 | 33 | 82 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 4e-51 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|