PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_32225 | ||||||||
Common Name | KK1_035274 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 179aa MW: 20369.6 Da PI: 10.1473 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 117.6 | 4.8e-37 | 30 | 86 | 3 | 59 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnv vG+grrk k C.cajan_32225 30 EKTIACPRCKSMETKFCYFNNYNVNQPRHFCKTCQRYWTAGGALRNVAVGAGRRKAK 86 6889***************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02701 | 4.7E-31 | 31 | 86 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 27.214 | 33 | 87 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 6.0E-24 | 33 | 86 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 35 | 71 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MAEESEGIKL FGATIRLNSG EVKKGEKGSE KTIACPRCKS METKFCYFNN YNVNQPRHFC 60 KTCQRYWTAG GALRNVAVGA GRRKAKPPCH APDGGLYETS DHDNKFEMVQ PQLPVPHTDF 120 RQIFPPKRRR ITSGILSFSI LIFFLSSNIL PIIKPSYNKT FYTRIMSCTN NYIASKIYK |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 126 | 130 | KRRRI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_32225 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 7e-55 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. | |||
GenBank | EF221752 | 7e-55 | EF221752.1 Glycine max Dof10 transcription factor (Dof10) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020238716.1 | 7e-98 | cyclic dof factor 4 | ||||
Swissprot | O22967 | 8e-41 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A151RL59 | 1e-132 | A0A151RL59_CAJCA; Dof zinc finger protein DOF2.3 | ||||
STRING | GLYMA15G08860.1 | 2e-68 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6483 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 3e-39 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|