PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_31669 | ||||||||
Common Name | Dof34 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 141aa MW: 16119.1 Da PI: 9.336 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 124.3 | 3.9e-39 | 24 | 81 | 2 | 59 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k C.cajan_31669 24 PDKIIPCPRCNSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAK 81 68999***************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 4.0E-29 | 23 | 81 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 2.4E-32 | 26 | 81 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.407 | 28 | 82 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 30 | 66 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MLCGREIKED KNESEDDGTE EKRPDKIIPC PRCNSMETKF CYFNNYNVNQ PRHFCKGCQR 60 YWTAGGALRN VPVGAGRRKA KPPYHDTDGG FAATVQQQFG LKGLALNEWH VHIHTVAHGD 120 FRQFFPSKRR SMSSGGQRQP F |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_31669 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP662920 | 0.0 | KP662920.1 Cajanus cajan Dof34 (Dof34) gene, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020236451.1 | 1e-105 | cyclic dof factor 4 | ||||
Swissprot | O22967 | 3e-51 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A0K8K5V6 | 1e-104 | A0A0K8K5V6_CAJCA; Dof protein | ||||
STRING | GLYMA05G29090.1 | 1e-60 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6483 | 32 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 1e-53 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|