PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_31413 | ||||||||
Common Name | KK1_033659 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 209aa MW: 22101.6 Da PI: 8.2122 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 212.2 | 1.2e-65 | 7 | 150 | 2 | 154 |
DUF702 2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaesk 97 +sg+++CqdCGnqakkdCah RCRtCCksrgf+C+thvkstWvpaakrrerqq laa+++ + ++ +kr+r++ +l++++ + ++ C.cajan_31413 7 GSGGVNCQDCGNQAKKDCAHLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQLLAASHHPQ-LCGGDNIPKRHRDS------QLACSSQPITT-- 93 57899**********************************************99999875555.44678888999875......44444434333.. PP DUF702 98 keletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 le ++P+ev+++avfrcvrvs+vd ++e++aYqt+v+igGhvfkGiLydqG+e+ C.cajan_31413 94 AGLELGQFPPEVNTSAVFRCVRVSAVDASDEQCAYQTSVNIGGHVFKGILYDQGPES 150 4688999************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 9.7E-62 | 10 | 149 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 4.7E-27 | 12 | 54 | IPR006510 | Zinc finger, lateral root primordium type 1 |
TIGRFAMs | TIGR01624 | 4.4E-25 | 100 | 148 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
MRSGGSGSGG VNCQDCGNQA KKDCAHLRCR TCCKSRGFQC QTHVKSTWVP AAKRRERQQL 60 LAASHHPQLC GGDNIPKRHR DSQLACSSQP ITTAGLELGQ FPPEVNTSAV FRCVRVSAVD 120 ASDEQCAYQT SVNIGGHVFK GILYDQGPES SYTSAPAEGS SGGEPQQLGL ITAATTATTG 180 GNPFEPSLYP APLNAFIAGG TQFYQPPRS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:12361963, ECO:0000269|PubMed:16740145, ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18811619, ECO:0000269|PubMed:20154152, ECO:0000269|PubMed:22318676}. | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Suppressor of the gibberellin (GA) signal transduction. {ECO:0000269|PubMed:10368174, ECO:0000269|PubMed:11706176, ECO:0000269|PubMed:16740146}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_31413 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Regulated by ESR1 and ESR2. {ECO:0000269|PubMed:21976484}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 2e-98 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020237326.1 | 1e-154 | protein SHI RELATED SEQUENCE 1 | ||||
Swissprot | Q9SD40 | 1e-66 | SRS1_ARATH; Protein SHI RELATED SEQUENCE 1 | ||||
Swissprot | Q9XGX0 | 1e-66 | SHI_ARATH; Protein SHORT INTERNODES | ||||
TrEMBL | A0A151RQN6 | 1e-153 | A0A151RQN6_CAJCA; Uncharacterized protein | ||||
STRING | XP_007136048.1 | 1e-112 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF882 | 34 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G51060.1 | 1e-66 | Lateral root primordium (LRP) protein-related |
Publications ? help Back to Top | |||
---|---|---|---|
|