PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_28722
Common NameKK1_030124
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family TCP
Protein Properties Length: 376aa    MW: 41446.1 Da    PI: 9.8811
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_28722genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP89.47.7e-2851120372
            TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                    g+kdrhsk++T +g+RdRR+Rls+++a++++dLqd+LG+ ++sk i+WLl++ k  i++l+ +++++  +
  C.cajan_28722  51 GGKDRHSKVCTIRGLRDRRIRLSVPTAIQLYDLQDKLGLSQPSKVIDWLLEATKFDIDKLPPLQFPQGFA 120
                    79*************************************************************5555422 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.8E-2652164IPR005333Transcription factor, TCP
PROSITE profilePS5136928.28752110IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MIIMSSSRED SQAKQEGDTN SIKFSKASST TSRQWSAFRN PRIVRVSRSF GGKDRHSKVC  60
TIRGLRDRRI RLSVPTAIQL YDLQDKLGLS QPSKVIDWLL EATKFDIDKL PPLQFPQGFA  120
QFHHPQTLLP FHGSSAASQL SLGPLCDASS TLVRDGGIQN LMAKSRYWEN MDSISRLKGK  180
EAEKGKWIKT NEQENQDGYN DLQVSTQRLF PMGSSATTTH SLLPGLLNNT MSYNSYNSEP  240
SSLSLSQFGS HGFFPSQQVD PNNPSNGNGV QFPSSLPLPP SGSQFLFGSS SATPSIFTTY  300
ASFTTPSVDN DPRQFNHIQF LNSGSQLLPH HPLIPSLHSF NSPVRPFPAT PFSSKLLASD  360
SNNDNSRSQQ DKGSTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-1757111155Putative transcription factor PCF6
5zkt_B1e-1757111155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_28722
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020234240.10.0transcription factor TCP5
RefseqXP_020234241.10.0transcription factor TCP5
TrEMBLA0A151S0B60.0A0A151S0B6_CAJCA; Transcription factor TCP5
STRINGGLYMA04G32324.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.15e-55TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5