PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_25279 | ||||||||
Common Name | KK1_025329 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 149aa MW: 17594.2 Da PI: 10.0843 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.1 | 1.8e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+i+fs++gkl+ey++ C.cajan_25279 9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYAT 59 79***********************************************86 PP | |||||||
2 | K-box | 79.5 | 8.4e-27 | 75 | 144 | 1 | 70 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 y++++ ++++++ + +++ e+++Lk++i+ Lqr++Rh++GedL+s+slkeLq+LeqqL+++lk+iR+++ C.cajan_25279 75 YAERQLVANDSESQGNWTIEYTRLKAKIDLLQRNHRHYMGEDLGSMSLKELQSLEQQLDTALKQIRTRRV 144 566778888889999****************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.394 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.7E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.44E-34 | 2 | 92 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.06E-41 | 2 | 79 | No hit | No description |
PRINTS | PR00404 | 1.3E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.5E-21 | 84 | 145 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.505 | 88 | 149 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009933 | Biological Process | meristem structural organization | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVALIVFSH KGKLFEYATD 60 SCMEKILERY ERYAYAERQL VANDSESQGN WTIEYTRLKA KIDLLQRNHR HYMGEDLGSM 120 SLKELQSLEQ QLDTALKQIR TRRVHKTYY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 6e-23 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. | |||||
UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00096 | ChIP-seq | Transfer from AT1G69120 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_25279 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB588744 | 0.0 | AB588744.1 Vigna unguiculata VuAP1 mRNA for APETALA1, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014624024.1 | 1e-102 | truncated transcription factor CAULIFLOWER A isoform X2 | ||||
Refseq | XP_028206840.1 | 1e-102 | truncated transcription factor CAULIFLOWER A-like isoform X2 | ||||
Swissprot | D7KWY6 | 2e-86 | AP1_ARALL; Floral homeotic protein APETALA 1 | ||||
Swissprot | Q6E6S7 | 2e-86 | AP1_VITVI; Agamous-like MADS-box protein AP1 | ||||
TrEMBL | A0A151SD93 | 1e-105 | A0A151SD93_CAJCA; Floral homeotic protein APETALA 1 | ||||
STRING | GLYMA16G13070.1 | 1e-100 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF588 | 32 | 119 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 7e-80 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|