PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_18982 | ||||||||
Common Name | KK1_019534 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 198aa MW: 21940.6 Da PI: 6.4862 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 21.9 | 3.6e-07 | 4 | 35 | 5 | 36 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg 36 C+ +++ e+ fC ++ lC++C ++H+ C.cajan_18982 4 QCDVCDKVEALVFCPADEAALCHTCDRTIHHA 35 7******99********************744 PP | |||||||
2 | zf-B_box | 29.7 | 1.3e-09 | 56 | 92 | 4 | 38 |
zf-B_box 4 rkCpeHeekelqlfCedCqqllCedClleeHkg..Ht 38 + C+ ++ek++ fC++++ lC++C l +H+ Ht C.cajan_18982 56 PLCDICQEKRAYVFCQEDRAILCRECDLPIHRAneHT 92 68*****************************767865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 10.352 | 1 | 47 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 7.59E-5 | 3 | 33 | No hit | No description |
SMART | SM00336 | 2.0E-6 | 4 | 47 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 6.1E-15 | 53 | 100 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 10.239 | 53 | 100 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 8.82E-9 | 56 | 100 | No hit | No description |
Pfam | PF00643 | 3.7E-8 | 56 | 92 | IPR000315 | B-box-type zinc finger |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:1900458 | Biological Process | negative regulation of brassinosteroid mediated signaling pathway | ||||
GO:2000306 | Biological Process | positive regulation of photomorphogenesis | ||||
GO:0005622 | Cellular Component | intracellular | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MKIQCDVCDK VEALVFCPAD EAALCHTCDR TIHHANKLAT KHARFSLHYP TSQDFPLCDI 60 CQEKRAYVFC QEDRAILCRE CDLPIHRANE HTQNHNRFLL TGVKLSGTSL DPISSSSTNC 120 TTGSQARSKM NRPRSVSNEN ASSSFKVEDN VASDTGSVST TTSSISEYLI ETIPGYCFED 180 LLDASFAPNG FCKVCYKP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as positive regulator of seedling photomorphogenesis. Plays a negative role in brassinosteroid responses. {ECO:0000269|PubMed:22535582}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_18982 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 8e-52 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020219957.1 | 1e-142 | B-box zinc finger protein 20 isoform X1 | ||||
Swissprot | Q0IGM7 | 3e-61 | BBX20_ARATH; B-box zinc finger protein 20 | ||||
TrEMBL | A0A151TCY9 | 1e-145 | A0A151TCY9_CAJCA; Putative salt tolerance-like protein At1g75540 family | ||||
STRING | GLYMA04G01120.1 | 1e-114 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1448 | 34 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G39070.1 | 3e-62 | DBB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|