PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_18887
Common NameKK1_019436, KK1_019444
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family TCP
Protein Properties Length: 292aa    MW: 32993.7 Da    PI: 10.0808
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_18887genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP155.24e-48221542132
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec..eaesssssasnsssgkaaksaa 95 
                    ++kkdrhskihT++g+RdRRvRls+e+a++fFdLqd+LGfdk+s+t++WL++++k+aikelt +++s+ s++  ++++ +s+ +++  +++++ + 
  C.cajan_18887  22 TTKKDRHSKIHTSQGLRDRRVRLSIEIARKFFDLQDMLGFDKASNTLDWLFTKSKKAIKELTLSKQSADSFSssSEGEVVSMIHQDLRQQQRRVDL 117
                    78**************************************************************99999777756666666666666667777777 PP

            TCP  96 kskksqksaasalnlakesrakarararertrekmri 132
                    +++  +++a ++ +++kesr+karararert++km++
  C.cajan_18887 118 EERMLKEPAYCVKAKMKESREKARARARERTSSKMCN 154
                    99999*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-4022153IPR005333Transcription factor, TCP
PROSITE profilePS5136936.4012482IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137011.188134151IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MLNQDLSGGA LYGIAKKPVK KTTKKDRHSK IHTSQGLRDR RVRLSIEIAR KFFDLQDMLG  60
FDKASNTLDW LFTKSKKAIK ELTLSKQSAD SFSSSSEGEV VSMIHQDLRQ QQRRVDLEER  120
MLKEPAYCVK AKMKESREKA RARARERTSS KMCNISGEGK VQELKKKCPA TENHPQILNQ  180
LRTPSPLQLH SQDMGGEVPR DDEFNVIEES IVIKRKLKHA LMSSIHQNVV IPKEASVSNS  240
DYNSFPNLCP NWEANNASTG RPAFCAIASM NLSTGLHIFG KSWEECTNPH PS
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_18887
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020220030.10.0transcription factor DICHOTOMA
RefseqXP_020220039.10.0transcription factor DICHOTOMA
TrEMBLA0A151TCU10.0A0A151TCU1_CAJCA; Transcription factor TCP1
STRINGGLYMA08G28691.11e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17383294
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.29e-27TCP family protein