PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_12924
Common NameKK1_013323
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family TCP
Protein Properties Length: 131aa    MW: 13725.6 Da    PI: 4.5757
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_12924genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP739.4e-231572483
            TCP 24 lsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83
                   ++ +caar+F+L++eLG+ +d++tieWLl+ a+p+i+++tgt++ +a  +   ss+ +++
  C.cajan_12924  1 MPPLCAARIFQLTRELGHRSDGETIEWLLRHAEPSIIAATGTGTVPAAPV---SSVAASA 57
                   899***************************************88888444...2222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.4E-18161IPR005333Transcription factor, TCP
PROSITE profilePS5136920.211139IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MPPLCAARIF QLTRELGHRS DGETIEWLLR HAEPSIIAAT GTGTVPAAPV SSVAASAPSA  60
EPSVACPLTA VAAHGMFAVP PPQPSCRLDL CPPPVMEFAA ANGYRHMPFT ALLLQPTAAE  120
DNQNDESLSE Q
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_12924
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020217985.12e-91transcription factor TCP11
SwissprotQ9SJK78e-32TCP11_ARATH; Transcription factor TCP11
TrEMBLA0A151TIW73e-89A0A151TIW7_CAJCA; Transcription factor TCP11
STRINGGLYMA13G20710.24e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.14e-26TCP family protein