PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_07419
Common NameKK1_007623
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family TCP
Protein Properties Length: 236aa    MW: 24900.9 Da    PI: 10.4535
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_07419genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1211.3e-3741042105
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaaks 97 
                    a++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti WLl+ a+pai+e+tgt++++a ++ ++    +  +ss+++ + +++++
  C.cajan_07419   4 AAAKRPSKDRHTKVEGRGRRIRMPATCAARIFQLTRELGHKSDGETIRWLLEHAEPAIIEATGTGTIPAIAV-SVGGALKIPTSSAARPEGEDTPR 98 
                    6799************************************************************99999555.22222222222222222222222 PP

            TCP  98 kksqksaa 105
                    k++++  a
  C.cajan_07419  99 KRRRR--A 104
                    22222..2 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136927.5121064IPR017887Transcription factor TCP subgroup
PfamPF036344.5E-301094IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0031347Biological Processregulation of defense response
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MSTAAAKRPS KDRHTKVEGR GRRIRMPATC AARIFQLTRE LGHKSDGETI RWLLEHAEPA  60
IIEATGTGTI PAIAVSVGGA LKIPTSSAAR PEGEDTPRKR RRRASNSEFI DVNESQVSVS  120
SGLAPIAQTA YGGGSGGGGL VPVWHGSNAS GPFFMFPNSS NPPQYWAIPA SATPFFNVQA  180
RPISVSVTSA ASASTSTSGS SSSAATTTQM LRDFSLEIYD KKELQFLGQP PPSSKE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197101RKRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00064PBMTransfer from AT5G51910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_07419
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020208401.11e-141transcription factor TCP19
SwissprotQ9LT895e-79TCP19_ARATH; Transcription factor TCP19
TrEMBLA0A151U6N11e-170A0A151U6N1_CAJCA; Transcription factor TCP19
STRINGGLYMA20G29330.31e-133(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.26e-73TCP family protein