PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_02883
Common NameKK1_002951
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family TCP
Protein Properties Length: 353aa    MW: 38914.1 Da    PI: 9.7306
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_02883genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP93.15.7e-2952134388
            TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                    g+kdrhsk++T +g+RdRR+Rls+++a +++dLqd+LG+ ++sk+++WLl++ k  i++l+ + ++++  c ++++    +ns+ +
  C.cajan_02883  52 GGKDRHSKVCTIRGLRDRRIRLSVPTAVQLYDLQDRLGLNQPSKAVDWLLEATKSDIDKLPPL-QIPH--CFTHQQTLLPGNSQFS 134
                    78*************************************************************.6666..4333333333333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.153111IPR017887Transcription factor TCP subgroup
PfamPF036343.2E-2753134IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MDIESSSKGH EASTQEEGNN IKTEKFLKAP STSRQWSAFR NPRIVRVSRT LGGKDRHSKV  60
CTIRGLRDRR IRLSVPTAVQ LYDLQDRLGL NQPSKAVDWL LEATKSDIDK LPPLQIPHCF  120
THQQTLLPGN SQFSLGPFYD PDSNFSKDGG NQNLMAKSRY WNIDSLNGKE LGESVSIFQK  180
GKSWIKRSEQ ENQDGISIGG THNREYSSAH KLFPIGTTNS SLLGNFLNNG MTHNSYHHSE  240
PSSLSLSHFG SHGLFPSHPS SGSGEQFSSS NFSGASGPQL LFCPPSATPS AFYSVESDPR  300
QSNILSSSSQ VMMPHPLIHP TNSPLRRLPT SFSSKLLGSD NNDRSQDKGS TRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-1958112155Putative transcription factor PCF6
5zkt_B2e-1958112155Putative transcription factor PCF6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_02883
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020228085.10.0transcription factor TCP5
RefseqXP_029129079.10.0transcription factor TCP5
TrEMBLA0A151SPF00.0A0A151SPF0_CAJCA; Transcription factor TCP5
STRINGXP_007155224.11e-169(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.15e-51TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5