PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa23770s010.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

MYB_related

Protein Properties

Length: 71aa MW: 8368.63 Da PI: 9.3563

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa23770s010.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	60.4	4e-19	3	50	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+lv ++k +G g+W++ +r g+ R++k+c++rw +yl Csa23770s010.1 3 KGAWTKEEDERLVSYIKSHGEGCWRSLPRAAGLLRCGKSCRLRWINYL 50 79****************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.099	1	54	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-21	2	49	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-13	2	52	IPR001005	SANT/Myb domain
Pfam	PF00249	2.0E-16	3	50	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.51E-21	4	71	IPR009057	Homeodomain-like
CDD	cd00167	5.85E-10	5	50	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.8E-7	50	71	IPR009057	Homeodomain-like
PROSITE profile	PS51294	7.371	55	71	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 71 aa Download sequence Send to blast
MNKGAWTKEE DERLVSYIKS HGEGCWRSLP RAAGLLRCGK SCRLRWINYL RPDLKRGNFT 60 HDEDELIIKL H

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	4e-14	1	71	25	94	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the negative regulation of flavonol biosynthesis. Represses the early phenylpropanoid genes, phenylalanine ammonia-lyase (PAL), cinnamate 4-hydroxylase (C4H) and 4-coumarate-CoA ligase (4CL), as well as the flavonoid-specific genes, flavonoid 3'-hydroxylase (F3'H) and dihydroflavonol 4-reductase (DFR) (PubMed:24319076). Plays a role in seed germination inhibition. Negatively regulates the expression of the abscisic acid (ABA) signaling transcription factor ABI5 in seeds (PubMed:25053018). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa23770s010.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and osmotic stress (PubMed:25053018). Induced by salt stress (PubMed:24319076, PubMed:25053018). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC005825	1e-91	AC005825.4 Arabidopsis thaliana chromosome 2 clone T24I21 map mi398, complete sequence.
GenBank	ATU26937	1e-91	U26937.1 Arabidopsis thaliana clone myb7 DNA-binding protein mRNA, complete cds.
GenBank	AY519573	1e-91	AY519573.1 Arabidopsis thaliana MYB transcription factor (At2g16720) mRNA, complete cds.
GenBank	CP002685	1e-91	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBank	X90385	1e-91	X90385.1 A.thaliana DNA for Y49 gene.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010467401.1	5e-46	PREDICTED: transcription factor MYB32-like
Swissprot	Q42379	5e-47	MYB7_ARATH; Transcription factor MYB7
TrEMBL	A0A1J3E1L1	5e-45	A0A1J3E1L1_NOCCA; Transcription factor MYB32 (Fragment)
TrEMBL	A0A1J3EMX5	9e-45	A0A1J3EMX5_NOCCA; Transcription factor MYB32 (Fragment)
TrEMBL	A0A1J3HX41	7e-45	A0A1J3HX41_NOCCA; Transcription factor MYB32 (Fragment)
STRING	XP_010467401.1	2e-45	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G16720.1	2e-49	myb domain protein 7

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]