PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa21991s010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 87aa MW: 9552.09 Da PI: 9.4244 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 203.1 | 2.9e-62 | 1 | 87 | 203 | 289 |
GAGA_bind 203 lDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhW 289 +D+s+lPvPvC+CtG+++qCY+WG+GGWqSaCCtt+iS+yPLP+stkrrgaRi+grKmSqgafkk+LekLa+eGy+++n++DLk+hW Csa21991s010.1 1 MDISGLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNISMYPLPMSTKRRGARISGRKMSQGAFKKVLEKLATEGYSFGNAIDLKSHW 87 8************************************************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01226 | 3.4E-13 | 1 | 87 | IPR010409 | GAGA-binding transcriptional activator |
Pfam | PF06217 | 3.1E-58 | 1 | 87 | IPR010409 | GAGA-binding transcriptional activator |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MDISGLPVPV CTCTGTPQQC YRWGCGGWQS ACCTTNISMY PLPMSTKRRG ARISGRKMSQ 60 GAFKKVLEKL ATEGYSFGNA IDLKSHW |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Negatively regulates the homeotic gene AGL11/STK, which controls ovule primordium identity, by a cooperative binding to purine-rich elements present in the regulatory sequence leading to DNA conformational changes. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:15722463}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa21991s010.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC254589 | 1e-108 | AC254589.1 Capsella rubella clone CAP16-D05, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010502189.1 | 6e-60 | PREDICTED: protein BASIC PENTACYSTEINE1 | ||||
Refseq | XP_010502201.1 | 6e-60 | PREDICTED: protein BASIC PENTACYSTEINE1-like | ||||
Swissprot | Q9SKD0 | 1e-59 | BPC1_ARATH; Protein BASIC PENTACYSTEINE1 | ||||
TrEMBL | R0HH84 | 4e-58 | R0HH84_9BRAS; Uncharacterized protein | ||||
STRING | XP_010502189.1 | 2e-59 | (Camelina sativa) | ||||
STRING | XP_010502201.1 | 2e-59 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6169 | 26 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G01930.2 | 4e-62 | basic pentacysteine1 |