PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa20g023370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family CO-like
Protein Properties Length: 358aa    MW: 39882.4 Da    PI: 6.619
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa20g023370.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.91.4e-051052440
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    ++C+ + +   + +C+ ++ +lC +C  + H        H++v
  Csa20g023370.1 10 QVCDSCRSAACTVYCHADSAYLCTSCDAQVHAVnrlasrHERV 52
                    68******99*******************99335577777765 PP

2zf-B_box36.41.1e-115297342
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                     r+C+ +e+ ++ +fC+ +   lC  C +e+H+       H++vp+
  Csa20g023370.1 52 VRVCQSCERAPAAFFCKADAASLCTACDSEIHSAnplarrHQRVPI 97
                    689*****************************66899999**9997 PP

3CCT64.53.2e-22288332145
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                     R+a+++RY+eK+k RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  Csa20g023370.1 288 RQARVMRYREKKKMRKFEKTIRYASRKAYAEKRPRIKGRFAKRKE 332
                     99****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.1E-8754IPR000315B-box-type zinc finger
PROSITE profilePS5011910.95754IPR000315B-box-type zinc finger
CDDcd000211.76E-71154No hitNo description
PROSITE profilePS5011912.2875097IPR000315B-box-type zinc finger
PfamPF006433.1E-95297IPR000315B-box-type zinc finger
CDDcd000213.58E-95397No hitNo description
SMARTSM003362.7E-125597IPR000315B-box-type zinc finger
PROSITE profilePS5101716.549288330IPR010402CCT domain
PfamPF062031.4E-16288330IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MLKEESNWAQ VCDSCRSAAC TVYCHADSAY LCTSCDAQVH AVNRLASRHE RVRVCQSCER  60
APAAFFCKAD AASLCTACDS EIHSANPLAR RHQRVPILPI SGNSYGSMET NHSCETTVTD  120
PENSMVLVGQ EEEDRDEAEA ASWLLPNLGK NSGINNNNSQ NNGFSIGDEY LDLVDYSSSM  180
DQSSQYQQHR NVPERSYRED GVVPLQVDES KSHHKHHEEL NFELGITYAP PSSSNGFISH  240
MVHVSSIDLG VVPESTTSDA TVSHPRSPKA VTERIPEPPA QMLSPMERQA RVMRYREKKK  300
MRKFEKTIRY ASRKAYAEKR PRIKGRFAKR KEVDAEADQA FSTTITFDTG YGIVPSL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1295301REKKKMR
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa20g023370.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0650011e-160AY065001.1 Arabidopsis thaliana AT5g15850/F14F8_230 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010492435.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 1-like
SwissprotO500550.0COL1_ARATH; Zinc finger protein CONSTANS-LIKE 1
TrEMBLR0HBC40.0R0HBC4_9BRAS; Uncharacterized protein
STRINGXP_010492435.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15850.11e-163CONSTANS-like 1
Publications ? help Back to Top
  1. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]
  2. An C, et al.
    Mediator subunit MED25 links the jasmonate receptor to transcriptionally active chromatin.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(42): p. E8930-E8939
    [PMID:28973940]
  3. Ordoñez-Herrera N, et al.
    The Transcription Factor COL12 Is a Substrate of the COP1/SPA E3 Ligase and Regulates Flowering Time and Plant Architecture.
    Plant Physiol., 2018. 176(2): p. 1327-1340
    [PMID:29187570]