PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa20g012050.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 201aa MW: 22252.3 Da PI: 5.3848 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.4 | 7.6e-09 | 11 | 55 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 W+ e+d + +a + + +W++Ia+ ++ g++ +q+k+++ Csa20g012050.1 11 VWSREDDIAFERALANNSDEseeRWDKIAADVP-GKSVEQIKEHYE 55 6*****************99*************.**********96 PP | |||||||
2 | Myb_DNA-binding | 42.9 | 1.1e-13 | 119 | 163 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E+ l++ + ++G+g+W++I+r + +Rt+ q+ s+ qky Csa20g012050.1 119 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 163 6*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 7.344 | 7 | 62 | IPR017884 | SANT domain |
SMART | SM00717 | 1.1E-7 | 8 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-7 | 11 | 55 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.10E-7 | 12 | 58 | No hit | No description |
SuperFamily | SSF46689 | 1.66E-9 | 12 | 65 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.8E-4 | 12 | 55 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.581 | 111 | 168 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.36E-17 | 114 | 169 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.2E-10 | 116 | 166 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 1.3E-17 | 116 | 166 | IPR006447 | Myb domain, plants |
CDD | cd00167 | 8.01E-10 | 119 | 164 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.4E-11 | 119 | 162 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.4E-11 | 119 | 163 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MTVEEVSEGP VWSREDDIAF ERALANNSDE SEERWDKIAA DVPGKSVEQI KEHYELLVED 60 VSRIESGCVP LPDYGSPERS NGHAGDEGGS SKKGGNNHAG ESNQGGKSKA DQERRKGIAW 120 TEDEHRLFLL GLDKYGKGDW RSISRNFVVT RTPTQVASHA QKYFIRLNSM NKDRRRSSIH 180 DITSVGNADV STPQGPITGQ N |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 1e-15 | 9 | 74 | 8 | 73 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa20g012050.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY072090 | 0.0 | AY072090.1 Arabidopsis thaliana unknown protein (At5g08520) mRNA, complete cds. | |||
GenBank | AY096571 | 0.0 | AY096571.1 Arabidopsis thaliana unknown protein (At5g08520) mRNA, complete cds. | |||
GenBank | AY519532 | 0.0 | AY519532.1 Arabidopsis thaliana MYB transcription factor (At5g08520) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010495118.2 | 1e-148 | PREDICTED: transcription factor DIVARICATA-like isoform X1 | ||||
Refseq | XP_019098036.1 | 1e-148 | PREDICTED: transcription factor DIVARICATA-like isoform X2 | ||||
Swissprot | Q9FNN6 | 1e-139 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | D7M1F0 | 1e-138 | D7M1F0_ARALL; Myb family transcription factor (Fragment) | ||||
STRING | XP_010495118.1 | 1e-147 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3556 | 28 | 61 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08520.1 | 1e-142 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|