PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa20426s010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 72aa MW: 8338.65 Da PI: 11.1567 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 126.6 | 7.3e-40 | 14 | 71 | 3 | 60 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 e+al+cprCdstntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg r+nk+ Csa20426s010.1 14 EAALNCPRCDSTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNKR 71 6789****************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 3.0E-36 | 1 | 71 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 5.8E-34 | 15 | 71 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 29.236 | 17 | 71 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 19 | 55 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 72 aa Download sequence Send to blast |
MVERARIAKV PLPEAALNCP RCDSTNTKFC YFNNYSLTQP RHFCKTCRRY WTRGGALRNV 60 PVGGGFRRNK RS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa20426s010.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493653 | 3e-98 | AB493653.1 Arabidopsis thaliana At3g55370 mRNA for hypothetical protein, partial cds, clone: RAAt3g55370. | |||
GenBank | AF155818 | 3e-98 | AF155818.1 Arabidopsis thaliana zinc finger protein OBP3 mRNA, complete cds. | |||
GenBank | AK221402 | 3e-98 | AK221402.1 Arabidopsis thaliana mRNA for zinc finger protein OBP3, complete cds, clone: RAFL25-48-C17. | |||
GenBank | AL132975 | 3e-98 | AL132975.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T22E16. | |||
GenBank | BT033028 | 3e-98 | BT033028.1 Arabidopsis thaliana unknown protein (At3g55370) mRNA, complete cds. | |||
GenBank | CP002686 | 3e-98 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006291398.1 | 1e-47 | dof zinc finger protein DOF3.6 isoform X1 | ||||
Swissprot | Q9M2U1 | 4e-48 | DOF36_ARATH; Dof zinc finger protein DOF3.6 | ||||
TrEMBL | R0FQ93 | 3e-46 | R0FQ93_9BRAS; Uncharacterized protein | ||||
STRING | XP_006291398.1 | 5e-47 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1713 | 28 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G55370.1 | 2e-50 | OBF-binding protein 3 |