PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa20018s010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 92aa MW: 10931.3 Da PI: 10.5469 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 76.3 | 4.8e-24 | 16 | 90 | 1 | 77 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsesss 77 rW+++ev+aLi r+++e++ + k+ W+e+s++m+erg+ rs+k+Ckekwen+nk+y+++ eg +k+ +e+s+ Csa20018s010.1 16 RWPQEEVQALISTRSDVEDKAVMN-NKGSIWDEISARMKERGYDRSAKKCKEKWENMNKYYRRVMEGGRKQ-PEHSK 90 8*****************997765.89****************************************9995.77775 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 0.0069 | 13 | 74 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.82E-5 | 14 | 74 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.7E-6 | 15 | 72 | IPR009057 | Homeodomain-like |
Pfam | PF13837 | 9.3E-20 | 15 | 88 | No hit | No description |
PROSITE profile | PS50090 | 7.596 | 16 | 72 | IPR017877 | Myb-like domain |
CDD | cd12203 | 6.26E-19 | 17 | 78 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
EIKFRYSRGG SSSGRRWPQE EVQALISTRS DVEDKAVMNN KGSIWDEISA RMKERGYDRS 60 AKKCKEKWEN MNKYYRRVME GGRKQPEHSK TR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specific DNA sequence. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa20018s010.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB025628 | 4e-92 | AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7. | |||
GenBank | AK118665 | 4e-92 | AK118665.1 Arabidopsis thaliana At5g47660 mRNA for unknown protein, complete cds, clone: RAFL19-93-K15. | |||
GenBank | CP002688 | 4e-92 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010441426.1 | 2e-59 | PREDICTED: trihelix transcription factor GTL1 | ||||
Refseq | XP_010495821.2 | 2e-60 | PREDICTED: trihelix transcription factor GTL1-like | ||||
Swissprot | Q39117 | 2e-21 | TGT2_ARATH; Trihelix transcription factor GT-2 | ||||
TrEMBL | D7MP23 | 9e-45 | D7MP23_ARALL; Predicted protein | ||||
STRING | XP_010441426.1 | 6e-59 | (Camelina sativa) | ||||
STRING | XP_010495821.1 | 1e-59 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9411 | 27 | 36 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47660.1 | 9e-45 | Trihelix family protein |