PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa19g015190.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 213aa MW: 23944.6 Da PI: 10.1836 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.6 | 3.3e-14 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd lv ++k +G g+W a++ g+ R++ +c++rw++yl Csa19g015190.1 14 KGEWTAEEDRTLVAYIKVHGLGNWCILAKKAGLPRCGRSCRLRWLNYL 61 799*****************************99************97 PP | |||||||
2 | Myb_DNA-binding | 48.6 | 1.9e-15 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r ++T++E+ +++++++ G++ W+ Ia+ ++ +Rt+ ++k++w++ Csa19g015190.1 67 RSKFTPQEENEIIKYHALIGNR-WAVIAKQLP-NRTDHDIKNHWNSC 111 789*******************.*********.***********975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.903 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.23E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.3E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.7E-12 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-22 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.67E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.291 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 6.7E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-14 | 67 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.2E-24 | 69 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.45E-9 | 69 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 213 aa Download sequence Send to blast |
MGRMTWVDAN GMKKGEWTAE EDRTLVAYIK VHGLGNWCIL AKKAGLPRCG RSCRLRWLNY 60 LRPGIKRSKF TPQEENEIIK YHALIGNRWA VIAKQLPNRT DHDIKNHWNS CLKKRLAKER 120 IDPMTHEPTV LTVETTSSST TSPSSTPSPT SSSFSSTGSA RLLNKLAAGI ASRIYRPDKI 180 KMVIFSEEPR EASDQEKMLI TMGGFDCLFY GL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-27 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:22575450, ECO:0000269|PubMed:25060192}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa19g015190.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:25060192}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010487946.1 | 1e-122 | PREDICTED: transcription factor MYB34-like | ||||
Swissprot | Q9M0J5 | 8e-54 | MYB41_ARATH; Transcription factor MYB41 | ||||
TrEMBL | R0I0D0 | 1e-106 | R0I0D0_9BRAS; Uncharacterized protein | ||||
STRING | XP_010487946.1 | 1e-121 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74430.1 | 7e-91 | myb domain protein 95 |
Publications ? help Back to Top | |||
---|---|---|---|
|