PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g059430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 441aa    MW: 49873.1 Da    PI: 7.355
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g059430.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3703.1e-22103204199
                     EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f kvlt sd++++g l+l kk+a e+     ++++  +++l+++d++ ++W++k+++r++++r+++t+GW  Fv +++L +gD +++   +r+++
  Csa17g059430.1 103 FTKVLTASDTSTHGVLSLRKKHALEClppldMSQPVPTQELVVKDLHDNQWTFKHTFRGTPRRHLFTTGWTAFVTSKKLVAGDNFIIL--RRENG 195
                     89****************************9666667779*******************************************99999..5799* PP

                     ..EEEEE-S CS
              B3  91 elvvkvfrk 99 
                     el+v+++r+
  Csa17g059430.1 196 ELLVGIRRA 204
                     *******97 PP

2Auxin_resp98.87.5e-33229308183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     +a+a++t+++F vvY+Pra  s+Fvv+++k+++alk+k+  G+Rf+m+fe+ed+se+r+sG+v+g +dl+p +W+nS+WrsL+
  Csa17g059430.1 229 VANAFNTNCMFIVVYKPRA--SQFVVRYDKFVDALKNKFNFGSRFRMRFEGEDFSEKRYSGIVIGEKDLSP-HWKNSEWRSLE 308
                     6899**************8..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-3495214IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.22E-28101205IPR015300DNA-binding pseudobarrel domain
CDDcd100177.87E-21102203No hitNo description
SMARTSM010194.5E-21103205IPR003340B3 DNA binding domain
PROSITE profilePS5086312.323103205IPR003340B3 DNA binding domain
PfamPF023629.4E-19103204IPR003340B3 DNA binding domain
PfamPF065073.6E-28229307IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MENNEDMNSQ PELLSITRGK EVYYFPHGHI ELVETSTREL LLDEMRPNIN LPSKLPCRVI  60
AIQLKVEKNT DEVYAQISLM PDTTEVVIPI TNDGSRKPMV CSFTKVLTAS DTSTHGVLSL  120
RKKHALECLP PLDMSQPVPT QELVVKDLHD NQWTFKHTFR GTPRRHLFTT GWTAFVTSKK  180
LVAGDNFIIL RRENGELLVG IRRAKYEIDH IPLSLISTQC MLHGVIASVA NAFNTNCMFI  240
VVYKPRASQF VVRYDKFVDA LKNKFNFGSR FRMRFEGEDF SEKRYSGIVI GEKDLSPHWK  300
NSEWRSLEVQ WDEVSPQKPS KVSLWEIEHL VPSSNILNTT LLKKESPCHL EMGSSSSILS  360
TDNQIGRSNM SSPKNVSYHD VVDDSKVSYG SLMSYRVPTM PNPNCATDQI VQPMQENITT  420
DATTSCMLFG VDLLATPSKK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1081333031355Auxin response factor 1
4ldw_A1e-1081333031355Auxin response factor 1
4ldw_B1e-1081333031355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa17g059430.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019095946.10.0PREDICTED: auxin response factor 13-like
SwissprotQ9FX250.0ARFM_ARATH; Auxin response factor 13
TrEMBLD7KJF30.0D7KJF3_ARALL; Auxin response factor
STRINGXP_010501775.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34170.10.0AUXIN RESPONSE FACTOR 13