PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g028400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 421aa    MW: 47442 Da    PI: 7.0351
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g028400.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.94.1e-14140234198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f+kvl +sdv++ g  +++  ++ + +  ++e++ l++ d ++++W++k++y+ + + + +t+GW +Fv  ++L  gD++vF    +++  l+++
  Csa17g028400.1 140 FIKVLDQSDVTNPGECTISAACLGADKVLPKEDTLLSIHDIHSQEWKLKHTYDSTLELHKFTDGWDRFVLTKQLSPGDSLVFV---KTRVGLTIG 231
                     899*******************988866667889************************************************9...344447888 PP

                     EE- CS
              B3  96 vfr 98 
                     ++r
  Csa17g028400.1 232 IRR 234
                     887 PP

2Auxin_resp43.41.5e-15283361683
      Auxin_resp   6 stksvFevvYnPrastseFvvkvekvekalk.vkvsvGmRfkmafetedsserrl.sGtvvgvsdldpvrWpnSkWrsLk 83 
                     + + +F+vvY+P +++s Fv  +e+v +a+  v + +Gm+++  +  +d+ +  +  G v++  + d   W +S+Wr+L+
  Csa17g028400.1 283 QIGRPFDVVYYPHVGSSSFVLDRERVYNAIWnVTWPPGMKVRKWVMVKDQLRVIChEGSVISSIKKDK-DWYGSPWRQLQ 361
                     55789********************99998549********999999999888888998888877677.9********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508639.643140236IPR003340B3 DNA binding domain
CDDcd100173.58E-10140234No hitNo description
PfamPF023626.0E-11140234IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-14140234IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-12140227IPR015300DNA-binding pseudobarrel domain
PfamPF065077.7E-12284361IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MKEKKNKLQS SPALTLKNNN ARPPRVFNTN LPNLRMEEED KSIDLSVWAY CAGVFDFDHL  60
QGRVYYSPQG HVENFTSSDI VRYLCSDLAM VPCELVTAKY LADPKTDEVF AYFKLKPPTS  120
DDDPNEETCC RETIRSADGF IKVLDQSDVT NPGECTISAA CLGADKVLPK EDTLLSIHDI  180
HSQEWKLKHT YDSTLELHKF TDGWDRFVLT KQLSPGDSLV FVKTRVGLTI GIRRVTVPGS  240
ASVDSFFHYP TRVNDVHGGQ KLIRTGKGLL SVEALGEALA KSQIGRPFDV VYYPHVGSSS  300
FVLDRERVYN AIWNVTWPPG MKVRKWVMVK DQLRVICHEG SVISSIKKDK DWYGSPWRQL  360
QVNWDKKYGS VEEFVNFWEV EPVPEPVSGK KRKLGDMTAT QATTTGQTGQ TMPDLILIKE  420
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A9e-244738323355Auxin response factor 1
4ldy_B9e-244738323355Auxin response factor 1
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa17g028400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019094428.10.0PREDICTED: auxin response factor 17-like
STRINGXP_010480582.10.0(Camelina sativa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77850.19e-52auxin response factor 17