PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa16g007040.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 174aa MW: 19243.9 Da PI: 9.7731 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 124.1 | 4.4e-39 | 57 | 115 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k Csa16g007040.1 57 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCHRYWTAGGALRNVPVGAGRRKSKP 115 68999***************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 3.0E-29 | 56 | 114 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 5.7E-32 | 59 | 114 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.369 | 61 | 115 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 63 | 99 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MATQDSQGIK LFGKTIAFNN TQTLKKEQEI KQPPESEATT AVRSSSTSSD LTAEKRPDKI 60 IPCPRCKSME TKFCYFNNYN VNQPRHFCKG CHRYWTAGGA LRNVPVGAGR RKSKPPGRVM 120 VGMLGDSNGV HQVELINGLL VEEWQHAAAA AHGGFRHDFP MKRLRCYSDG QSC* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa16g007040.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC002341 | 1e-160 | AC002341.3 Arabidopsis thaliana chromosome 2 clone T14G11 map TEn5, complete sequence. | |||
GenBank | AK221308 | 1e-160 | AK221308.1 Arabidopsis thaliana mRNA for putative DOF zinc finger protein, complete cds, clone: RAFL25-04-B19. | |||
GenBank | BT010496 | 1e-160 | BT010496.1 Arabidopsis thaliana At2g34140 gene, complete cds. | |||
GenBank | CP002685 | 1e-160 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010469397.1 | 1e-130 | PREDICTED: cyclic dof factor 4 | ||||
Swissprot | O22967 | 1e-114 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | R0HFI0 | 1e-114 | R0HFI0_9BRAS; Uncharacterized protein | ||||
STRING | XP_010469397.1 | 1e-130 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2809 | 26 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 2e-94 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|