PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa15g024970.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 217aa MW: 25537.4 Da PI: 10.3103 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 173.2 | 7.7e-54 | 43 | 165 | 1 | 125 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdeel+++yL +kv+++ ++ +++ +vd++k+ePwdLp+k++ +ekewyfFs+rd+ky+tg r+nrat++gyWk+tgkdke+++ Csa15g024970.1 43 LPPGFRFHPTDEELITHYLVRKVSDTGFTG-KAVVDVDLNKCEPWDLPAKASMGEKEWYFFSQRDRKYPTGLRTNRATEAGYWKTTGKDKEIYR- 135 79*************************999.88***************999999****************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmhe 125 +g lvg+kktLvfykgrapkgek++Wvmhe Csa15g024970.1 136 SGVLVGMKKTLVFYKGRAPKGEKSNWVMHE 165 999**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.15E-57 | 38 | 165 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.213 | 43 | 184 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.4E-27 | 44 | 165 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
VTLIIEKLLA VNLLRLLQER EENHSSYFCC LKLEDNKKME DNLPPGFRFH PTDEELITHY 60 LVRKVSDTGF TGKAVVDVDL NKCEPWDLPA KASMGEKEWY FFSQRDRKYP TGLRTNRATE 120 AGYWKTTGKD KEIYRSGVLV GMKKTLVFYK GRAPKGEKSN WVMHERNGLY VGYSKRARQR 180 RKHKNNNLNL HNHLLDLHAM RIHQWQMNLK ISRFRI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 4e-51 | 42 | 165 | 19 | 142 | NAC domain-containing protein 19 |
3swm_B | 4e-51 | 42 | 165 | 19 | 142 | NAC domain-containing protein 19 |
3swm_C | 4e-51 | 42 | 165 | 19 | 142 | NAC domain-containing protein 19 |
3swm_D | 4e-51 | 42 | 165 | 19 | 142 | NAC domain-containing protein 19 |
3swp_A | 4e-51 | 42 | 165 | 19 | 142 | NAC domain-containing protein 19 |
3swp_B | 4e-51 | 42 | 165 | 19 | 142 | NAC domain-containing protein 19 |
3swp_C | 4e-51 | 42 | 165 | 19 | 142 | NAC domain-containing protein 19 |
3swp_D | 4e-51 | 42 | 165 | 19 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa15g024970.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB026658 | 1e-101 | AB026658.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MYF24. | |||
GenBank | CP002686 | 1e-101 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019092242.1 | 1e-121 | PREDICTED: NAC domain-containing protein 72-like | ||||
Swissprot | Q9FLJ2 | 1e-70 | NC100_ARATH; NAC domain-containing protein 100 | ||||
TrEMBL | A0A178VF42 | 1e-88 | A0A178VF42_ARATH; NAC058 | ||||
STRING | XP_010465939.1 | 2e-91 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5527 | 26 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G18400.1 | 1e-92 | NAC domain containing protein 58 |
Publications ? help Back to Top | |||
---|---|---|---|
|