PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa15g001870.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 251aa MW: 28568.5 Da PI: 8.552 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.8 | 2.2e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaev++i+fs++gklye++s Csa15g001870.1 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 93.1 | 4.9e-31 | 78 | 173 | 4 | 99 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + +++ +++ e++++e+ kLk ++e+Lqr+qR+llGedL++L+ keL+qLe+qL+ slk++R K++++l+q+++lq ke+ l e+n+aL++kl Csa15g001870.1 78 IEVNNKPAKELENSYREYLKLKGRYESLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHILLEANRALSMKL 172 56667788999**********************************************************************************99 PP K-box 99 e 99 e Csa15g001870.1 173 E 173 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.319 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.2E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.20E-45 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 1.06E-33 | 2 | 80 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.2E-24 | 85 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.474 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0071486 | Biological Process | cellular response to high light intensity | ||||
GO:0071492 | Biological Process | cellular response to UV-A | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 251 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVSLIVFSN RGKLYEFCST 60 SNMLKTLERY QKCSYGSIEV NNKPAKELEN SYREYLKLKG RYESLQRQQR NLLGEDLGPL 120 NSKELEQLER QLDGSLKQVR CIKTQYMLDQ LSDLQGKEHI LLEANRALSM KLEDMIGVRH 180 HHIGGAWEAG DQHNVAYGHH QAHSQGLYQS LECDPTLQIG YGHPVCSEQM AVTTQGQSQP 240 GNGYIPGWML * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ox0_A | 6e-34 | 75 | 174 | 1 | 103 | Developmental protein SEPALLATA 3 |
4ox0_B | 6e-34 | 75 | 174 | 1 | 103 | Developmental protein SEPALLATA 3 |
4ox0_C | 6e-34 | 75 | 174 | 1 | 103 | Developmental protein SEPALLATA 3 |
4ox0_D | 6e-34 | 75 | 174 | 1 | 103 | Developmental protein SEPALLATA 3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Functions with SEPALLATA1/AGL2 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels and to prevent the indeterminate growth of the flower meristem. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa15g001870.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ415918 | 0.0 | DQ415918.1 Boechera stricta SEP2 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010463632.1 | 0.0 | PREDICTED: developmental protein SEPALLATA 2-like | ||||
Swissprot | P29384 | 1e-179 | SEP2_ARATH; Developmental protein SEPALLATA 2 | ||||
TrEMBL | D7KZF6 | 1e-180 | D7KZF6_ARALL; SEPALLATA2 | ||||
TrEMBL | R0G6P7 | 1e-180 | R0G6P7_9BRAS; Uncharacterized protein | ||||
STRING | XP_010463632.1 | 0.0 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3289 | 27 | 65 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G02310.1 | 0.0 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|