PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g044280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 575aa    MW: 65281.4 Da    PI: 7.9993
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g044280.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.98e-23126226199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g l++p + a+e+      +++ + +++   +d++g++W++k+++r++++r+++t+GW+ Fv  ++L +gD++vF    r++
  Csa14g044280.1 126 FKKILTASDTSTHGGLSVPIRDATEClppldmSLPMP-TQEFLTKDLHGNEWRFKHSFRGTPRRHLITTGWSAFVTTKKLVAGDVLVFV---REN 216
                     89****************************9744444.458999*********************************************...799 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+v+++r+
  Csa14g044280.1 217 GELRVGIRRA 226
                     99*****996 PP

2Auxin_resp101.61e-33251330183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha+++k++F+vvY+Pr+  s+Fvv+++++++a+++k+ vG+Rf m+fe+ed+serr+sGt++gv++++p +W++S+WrsL+
  Csa14g044280.1 251 AVHAFHSKCMFTVVYKPRS--SQFVVRYDNFLDAMNKKFNVGSRFTMQFEGEDFSERRYSGTIIGVNNFSP-HWKDSEWRSLQ 330
                     799***************6..9*************************************************.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.4E-36114238IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.26E-29120251IPR015300DNA-binding pseudobarrel domain
CDDcd100171.03E-22125225No hitNo description
PROSITE profilePS5086312.844126227IPR003340B3 DNA binding domain
SMARTSM010197.0E-21126227IPR003340B3 DNA binding domain
PfamPF023621.4E-20126226IPR003340B3 DNA binding domain
PfamPF065078.5E-30251330IPR010525Auxin response factor
PfamPF023091.7E-5471513IPR033389AUX/IAA domain
PROSITE profilePS5174525.756477558IPR000270PB1 domain
SuperFamilySSF542772.9E-12479553No hitNo description
PfamPF023096.5E-6520564IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MESGHIVNAQ PELSGIVDET KSYIYEQLWN LCAGPLCDLP KLGDKVYYFP QGHIEFVEAS  60
TREELNQIQP NFDIPSKLKC HVIAIHRKVE KNTDQVYAEI TLMPDTTQVI IPTQNDSNDR  120
PKINFFKKIL TASDTSTHGG LSVPIRDATE CLPPLDMSLP MPTQEFLTKD LHGNEWRFKH  180
SFRGTPRRHL ITTGWSAFVT TKKLVAGDVL VFVRENGELR VGIRRAGHQQ GNIPSSLVST  240
ESMRLGVIVS AVHAFHSKCM FTVVYKPRSS QFVVRYDNFL DAMNKKFNVG SRFTMQFEGE  300
DFSERRYSGT IIGVNNFSPH WKDSEWRSLQ VRWDEFVSFP RPNRVSPWEI KHLTPSSNVI  360
QSSLLKNKRS RHANEIGSSS SHRLPPILIE GQKIGQPSMN CPMSIPQLSN RDAIEGGSCR  420
LFGVTLITPS EIKDPVEPND SYQISDTSKL SEERKLGLTP TSKSPTEIQS KQFSSIRSCT  480
KVQMQGATIG RALDLSVLNG YDQLIHELDK LFDLKGKLQT RNQWEIVFTD DEGDMMVVGD  540
DPWPEFCNMV KKIFILSKEE VNNLKWNQRF KMNQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1242735322355Auxin response factor 1
4ldw_A1e-1242735322355Auxin response factor 1
4ldw_B1e-1242735322355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa14g044280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019091439.10.0PREDICTED: putative auxin response factor 14 isoform X1
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLA0A178WK870.0A0A178WK87_ARATH; Auxin response factor
TrEMBLD7L9F70.0D7L9F7_ARALL; Auxin response factor
STRINGXP_010463133.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14