PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g044020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 290aa    MW: 32745.8 Da    PI: 8.006
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g044020.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.11.7e-23110211199
                     EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f k+lt sd++++g l+lpkk+a e+     ++++  +++l+++d++ ++W++k+++r++++r+++t+GW  Fv +++L +gD +++   + +++
  Csa14g044020.1 110 FTKALTASDTSTHGVLSLPKKHALEClppldMSQPVPTQELVVKDLHDNQWTFKHTFRGTPRRHLFTTGWTAFVTSKKLAAGDNFIIL--KGENG 202
                     89****************************9666667779*******************************************88888..45999 PP

                     ..EEEEE-S CS
              B3  91 elvvkvfrk 99 
                     el+v+++r+
  Csa14g044020.1 203 ELLVGIRRA 211
                     9******97 PP

2Auxin_resp58.43.1e-20236290157
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsser 57 
                     +++a++t+++F vvY+Pra  s+Fvv+++k+++alk+k+  G+Rfkm+ e+ed+se+
  Csa14g044020.1 236 VVNAFNTNCMFIVVYKPRA--SQFVVRYDKFVDALKNKFNFGSRFKMRCEGEDFSEK 290
                     68999*************8..9********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.5E-36103225IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.97E-29108212IPR015300DNA-binding pseudobarrel domain
CDDcd100172.20E-22109210No hitNo description
PfamPF023624.0E-20110211IPR003340B3 DNA binding domain
PROSITE profilePS5086312.858110212IPR003340B3 DNA binding domain
SMARTSM010199.9E-21110212IPR003340B3 DNA binding domain
PfamPF065072.6E-16237290IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
DGTKSYIYEQ LWNICAGPLC DLPKPGEKVY YFPQGHIELV ETSTREVLLD EMRPNINLPS  60
KLPCPVISIQ LKMEKNTDEV YAQISLMPDT TEVVIPITND GNRKPMVCSF TKALTASDTS  120
THGVLSLPKK HALECLPPLD MSQPVPTQEL VVKDLHDNQW TFKHTFRGTP RRHLFTTGWT  180
AFVTSKKLAA GDNFIILKGE NGELLVGIRR AKYEIDHIPS SVISAQCMLH GVIASVVNAF  240
NTNCMFIVVY KPRASQFVVR YDKFVDALKN KFNFGSRFKM RCEGEDFSEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1021029022306Auxin response factor 1
4ldw_A1e-1021029022306Auxin response factor 1
4ldw_B1e-1021029022306Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa14g044020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010461246.10.0PREDICTED: auxin response factor 12-like
SwissprotQ9XID41e-146ARFL_ARATH; Auxin response factor 12
TrEMBLD7KJF31e-144D7KJF3_ARALL; Auxin response factor
STRINGXP_010461246.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34310.11e-148auxin response factor 12