PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa14g031790.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 188aa MW: 21856.9 Da PI: 9.9874 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 172.6 | 1.2e-53 | 16 | 143 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 l pGfrFhPtdeelv++yLk+kv++++l++ e i+++diyk++PwdLpk + ++ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++++s+ Csa14g031790.1 16 LLPGFRFHPTDEELVSFYLKRKVQHNPLSI-ELIRQLDIYKYDPWDLPKFAMTGEKEWYFYCPRDRKYRNSSRPNRVTGAGFWKATGTDRPIYSS 109 579***************************.89***************7777889***************************************9 PP NAM 96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ +glkk+Lvfykgra kg+ktdW+mhe+rl Csa14g031790.1 110 eGNKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 143 56667***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.22E-57 | 12 | 146 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.779 | 16 | 175 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.7E-26 | 18 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MGERNDDGDQ KMEEVLLPGF RFHPTDEELV SFYLKRKVQH NPLSIELIRQ LDIYKYDPWD 60 LPKFAMTGEK EWYFYCPRDR KYRNSSRPNR VTGAGFWKAT GTDRPIYSSE GNKCIGLKKS 120 LVFYKGRAAK GVKTDWMMHE FRLPSLSEPS PPSKRFFDSP VSPNVSLQLA QIHGRYAESS 180 KRQTQRP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-53 | 1 | 143 | 1 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa14g031790.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC005508 | 1e-148 | AC005508.1 Arabidopsis thaliana chromosome I BAC T2P11 genomic sequence, complete sequence. | |||
GenBank | CP002684 | 1e-148 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019091044.1 | 1e-126 | PREDICTED: protein FEZ | ||||
Swissprot | Q9ZVH0 | 1e-111 | FEZ_ARATH; Protein FEZ | ||||
TrEMBL | A0A0D3CDG9 | 1e-115 | A0A0D3CDG9_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A397Y7C8 | 1e-115 | A0A397Y7C8_BRACM; Uncharacterized protein | ||||
TrEMBL | A0A3N6RD63 | 1e-117 | A0A3N6RD63_BRACR; Uncharacterized protein | ||||
TrEMBL | A0A3P6F171 | 1e-115 | A0A3P6F171_BRAOL; Uncharacterized protein | ||||
STRING | Bostr.12659s0312.1.p | 1e-118 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM306 | 28 | 200 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26870.1 | 1e-113 | NAC family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|