PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa13g056270.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

MYB_related

Protein Properties

Length: 91aa MW: 10565 Da PI: 4.644

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa13g056270.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	30.1	1.1e-09	46	84	4	44
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 + +eE++l + +k+ G + W++Ia +++ gRt++++ +w Csa13g056270.1 46 MNQEEEDLVCRMHKLVGDR-WELIAGRIP-GRTAEEIERFW 84 679************99.*****.******999 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	3.0E-7	42	90	IPR001005	SANT/Myb domain
CDD	cd00167	1.79E-6	45	84	No hit	No description
Pfam	PF00249	2.0E-8	47	85	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.95E-7	47	85	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	7.6E-11	47	85	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MNQEEEDLVC RMHKLVGDRT KQAKTNSIVT SSSEEVSSLE WEIVNMNQEE EDLVCRMHKL 60 VGDRWELIAG RIPGRTAEEI ERFWVMKTEK *

Functional Description ? help Back to Top
Source	Description
UniProt	MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269\|PubMed:18305006}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa13g056270.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY519522	8e-87	AY519522.1 Arabidopsis thaliana MYB transcription factor (At4g01060) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010422763.1	2e-45	PREDICTED: MYB-like transcription factor ETC3 isoform X1
Refseq	XP_010456208.1	2e-45	PREDICTED: MYB-like transcription factor ETC3 isoform X1
Swissprot	Q9M157	1e-30	ETC3_ARATH; MYB-like transcription factor ETC3
TrEMBL	D7M4Z5	6e-38	D7M4Z5_ARALL; Myb family transcription factor
STRING	XP_010422763.1	8e-45	(Camelina sativa)
STRING	XP_010456208.1	8e-45	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM323	28	194

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G01060.3	6e-28	CAPRICE-like MYB3

Publications ? help Back to Top
Koiwa H, et al. C-terminal domain phosphatase-like family members (AtCPLs) differentially regulate Arabidopsis thaliana abiotic stress signaling, growth, and development. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(16): p. 10893-8 [PMID:12149434] Nemie-Feyissa D,Olafsdottir SM,Heidari B,Lillo C Nitrogen depletion and small R3-MYB transcription factors affecting anthocyanin accumulation in Arabidopsis leaves. Phytochemistry, 2014. 98: p. 34-40 [PMID:24388610] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Tominaga-Wada R,Wada T The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis. J. Plant Physiol., 2016. 199: p. 111-115 [PMID:27302012] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]