PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa12g079710.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 200aa MW: 22743.4 Da PI: 7.2934 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53 | 7.6e-17 | 61 | 104 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++++ ++++++G++ W++Ia++++ gRt++++k++w++ Csa12g079710.1 61 RGNITAEEQLIIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 104 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 5.68 | 15 | 55 | IPR017877 | Myb-like domain |
SMART | SM00717 | 2.5 | 19 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-11 | 25 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 0.00167 | 26 | 55 | No hit | No description |
SuperFamily | SSF46689 | 4.6E-22 | 35 | 112 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.092 | 56 | 110 | IPR017930 | Myb domain |
SMART | SM00717 | 1.0E-14 | 60 | 108 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-15 | 61 | 104 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-23 | 63 | 109 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.51E-12 | 65 | 104 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MEKRVGGTGG SGSGDADVRK GPRTMEEDLI LINYITNHGL KRTGKSCRLR WLNYLRPDVR 60 RGNITAEEQL IIMELHAKWG NRWSKIAKHL PGRTDNEIKN FWRTKIQKYI IKNGETTTAG 120 SQSSEIINHH ATSTGQVLND TQEPIDTYSQ HANSIDHQLS YNTYVPESDS IMMPLSVDQS 180 EQNYWSVDDL WPMHLYNGN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-23 | 14 | 110 | 1 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor acting redundantly with MYB21 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB21 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:16972096, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21447791}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa12g079710.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by jasmonate. {ECO:0000269|PubMed:16805732}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF175987 | 1e-151 | AF175987.1 Arabidopsis thaliana putative transcription factor (MYB24) mRNA, complete cds. | |||
GenBank | AY519632 | 1e-151 | AY519632.1 Arabidopsis thaliana MYB transcription factor (At5g40350) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010435910.1 | 1e-137 | PREDICTED: transcription factor MYB24-like | ||||
Swissprot | Q9SPG9 | 1e-111 | MYB24_ARATH; Transcription factor MYB24 | ||||
TrEMBL | R0H558 | 1e-112 | R0H558_9BRAS; Uncharacterized protein | ||||
STRING | XP_010435910.1 | 1e-136 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40350.1 | 1e-113 | myb domain protein 24 |
Publications ? help Back to Top | |||
---|---|---|---|
|