PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g030420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 628aa    MW: 70900.2 Da    PI: 7.0525
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g030420.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.11.9e-24115216199
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +
  Csa12g030420.1 115 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFL--RGE 205
                     88****************************9643..445569************************************************..449 PP

                     EE..EEEEE-S CS
              B3  89 efelvvkvfrk 99 
                     ++el+v+v+r+
  Csa12g030420.1 206 NGELRVGVRRA 216
                     999******97 PP

2Auxin_resp1125.6e-37241320183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a ha++ k++F v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe+eds+err+sGtv+gv+d++p +W++SkWr+L+
  Csa12g030420.1 241 ACHATQAKTMFIVYYKPRT--SQFIISLNKYLEAMNNKFSVGMRFKMRFEGEDSPERRYSGTVIGVKDCSP-HWKDSKWRCLE 320
                     6799**************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.84E-39106244IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.1E-42108230IPR015300DNA-binding pseudobarrel domain
CDDcd100174.62E-21113215No hitNo description
PfamPF023623.5E-22115216IPR003340B3 DNA binding domain
PROSITE profilePS5086312.731115217IPR003340B3 DNA binding domain
SMARTSM010194.6E-24115217IPR003340B3 DNA binding domain
PfamPF065075.1E-33241319IPR010525Auxin response factor
PfamPF023091.1E-12494603IPR033389AUX/IAA domain
SuperFamilySSF542777.85E-13510591No hitNo description
PROSITE profilePS5174525.81515607IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MTNHGGEGLY DELWKLCAGP LVDVPQAGER VYYFPQGHME QLEASTQQDL NTRKPLFLLP  60
PKILCNVMNV RLQAEKDTDE VYAQITLIPV GTKVDEPMSP DPSPPETQKP KVHSFSKVLT  120
ASDTSTHGGF SVLRKHATEC LPPLDMTQQT PTQELVAEDV HGYQWKFKHI FRGQPRRHLL  180
TTGWSTFVTS KRLVAGDTFV FLRGENGELR VGVRRANRQQ SSMPSSVISS HSMHLGVLAT  240
ACHATQAKTM FIVYYKPRTS QFIISLNKYL EAMNNKFSVG MRFKMRFEGE DSPERRYSGT  300
VIGVKDCSPH WKDSKWRCLE VHWDEPASIP RPDKVSPWEI EPFATSESVP QSVMLMKKRP  360
RQASEVSALG ITASNLWQSH EFAQSCLTSQ RSSSQQCYRD STEDAKKSDW LNNSYSVSNL  420
SKDSTLNDQM VSPVEQKKPE TTANYRLFGI DLMSSSLAAS EEKTAPMRPI NITKSTPDSN  480
SDPKSEISKV SEEKKQEPPQ TSPKEVQSKQ ISSTRSRTKV QMQGVPVGRA VDLTALNGYN  540
ELIDDLEKLF DIKGELQSRN QWEIVFTDDE GDMMLVGDDP WPEFCNMVKR IFIWSKEEVK  600
KMTPGNQLRM MLTEVETTIS KSDNHSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-164734317355Auxin response factor 1
4ldw_A1e-164734317355Auxin response factor 1
4ldw_B1e-164734317355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa12g030420.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0821760.0AF082176.1 Arabidopsis thaliana auxin response factor 9 (ARF9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010448631.10.0PREDICTED: auxin response factor 9 isoform X2
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A178V4030.0A0A178V403_ARATH; Auxin response factor
STRINGXP_010448630.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9