PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Csa12g008980.1

Organism

Camelina sativa

Taxonomic ID

90675

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

bZIP

Protein Properties

Length: 158aa MW: 17761.8 Da PI: 5.2486

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa12g008980.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	37.1	6.9e-12	27	81	5	59
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 ++ +r+ +NRe+ArrsR +K++ ++ L+ v L++eN + ++ ++++ ++ Csa12g008980.1 27 RKRKRMLSNRESARRSRMKKQKLLDDLTAQVNHLKKENNEIVTSVSITTQHYLTV 81 7889**********************************98777666666666555 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	3.9E-10	19	68	No hit	No description
SMART	SM00338	2.5E-17	23	87	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.117	25	88	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	3.9E-9	26	67	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.88E-12	27	79	No hit	No description
CDD	cd14702	4.40E-17	28	78	No hit	No description
PROSITE pattern	PS00036	0	30	45	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 158 aa Download sequence Send to blast
MESSSSGTTS STIQSSSGSE ESLMEQRKRK RMLSNRESAR RSRMKKQKLL DDLTAQVNHL 60 KKENNEIVTS VSITTQHYLT VEAENSVLRA QLDELNHRLQ SLNDIIEFLD SNNNSNNGMC 120 SSNPLVGLEC DDFFVNQMNM SYMMNQPLMA SSDALLY*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	26	47	RKRKRMLSNRESARRSRMKKQK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:18088315, ECO:0000269\|PubMed:21534971, ECO:0000269\|PubMed:24861440}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa12g008980.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269\|PubMed:15047879, ECO:0000269\|PubMed:15208401, ECO:0000269\|PubMed:9620274, ECO:0000269\|PubMed:9721683}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AL023094	0.0	AL023094.2 Arabidopsis thaliana DNA chromosome 4, BAC clone T4L20 (ESSA project).
GenBank	AL161585	0.0	AL161585.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 81.
GenBank	AY063979	0.0	AY063979.1 Arabidopsis thaliana putative bZIP transcription factor ATB2 (At4g34590) mRNA, complete cds.
GenBank	AY096396	0.0	AY096396.1 Arabidopsis thaliana putative bZIP transcription factor ATB2 (At4g34590) mRNA, complete cds.
GenBank	CP002687	0.0	CP002687.1 Arabidopsis thaliana chromosome 4 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010447053.1	1e-111	PREDICTED: bZIP transcription factor 11-like
Swissprot	O65683	3e-87	BZP11_ARATH; bZIP transcription factor 11
TrEMBL	D7MEC5	5e-90	D7MEC5_ARALL; Transcription factor GBF6
STRING	XP_010447053.1	1e-110	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM501	28	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G34590.1	8e-82	G-box binding factor 6

Publications ? help Back to Top
Mair A, et al. SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants. Elife, 2016. [PMID:26263501] Sagor GH, et al. A novel strategy to produce sweeter tomato fruits with high sugar contents by fruit-specific expression of a single bZIP transcription factor gene. Plant Biotechnol. J., 2016. 14(4): p. 1116-26 [PMID:26402509] Walper E,Weiste C,Mueller MJ,Hamberg M,Dröge-Laser W Screen Identifying Arabidopsis Transcription Factors Involved in the Response to 9-Lipoxygenase-Derived Oxylipins. PLoS ONE, 2016. 11(4): p. e0153216 [PMID:27073862] Wang XY, et al. Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis. Plant Physiol. Biochem., 2016. 107: p. 273-287 [PMID:27337039] Weiste C, et al. The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth. PLoS Genet., 2017. 13(2): p. e1006607 [PMID:28158182] Yamashita Y, et al. Sucrose sensing through nascent peptide-meditated ribosome stalling at the stop codon of Arabidopsis bZIP11 uORF2. FEBS Lett., 2017. 591(9): p. 1266-1277 [PMID:28369795] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Lee DH,Park SJ,Ahn CS,Pai HS MRF Family Genes Are Involved in Translation Control, Especially under Energy-Deficient Conditions, and Their Expression and Functions Are Modulated by the TOR Signaling Pathway. Plant Cell, 2017. 29(11): p. 2895-2920 [PMID:29084871] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]