PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa11g084030.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 108aa MW: 12625 Da PI: 11.0649 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 80 | 2.4e-25 | 11 | 61 | 2 | 52 |
RWP-RK 2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 +k+++l+d+++ F+lpi+ AAk++++c+TvLK+iCR+ ++RWPhRkiksl Csa11g084030.2 11 TKRLTLKDINMLFHLPIETAAKQMNLCPTVLKKICRKGSLMRWPHRKIKSL 61 799**********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51519 | 16.529 | 1 | 81 | IPR003035 | RWP-RK domain |
Pfam | PF02042 | 7.8E-22 | 14 | 61 | IPR003035 | RWP-RK domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005515 | Molecular Function | protein binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MYRGQEQRER TKRLTLKDIN MLFHLPIETA AKQMNLCPTV LKKICRKGSL MRWPHRKIKS 60 LHTKITSLKS LVHTAKNDEV KARTEAEIER LQRRVDKICS DALKNMK* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa11g084030.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019087630.1 | 4e-65 | PREDICTED: uncharacterized protein LOC104728818 | ||||
TrEMBL | A0A1R7T3I3 | 2e-42 | A0A1R7T3I3_ARATH; RWP-RK domain protein | ||||
TrEMBL | R0GU10 | 1e-42 | R0GU10_9BRAS; Uncharacterized protein | ||||
STRING | XP_010446048.1 | 5e-64 | (Camelina sativa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53040.1 | 3e-13 | RWP-RK domain-containing protein |