PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa11g057470.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 220aa MW: 25015.6 Da PI: 8.8902 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.1 | 1.9e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd++l d+v+ +G g+W++Ia++ g++R++k+c++rw +yl Csa11g057470.1 14 KGLWTVEEDKILMDYVRTHGQGHWNRIAKKTGLKRCGKSCRLRWMNYL 61 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 60.3 | 4.3e-19 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T +E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l Csa11g057470.1 67 RGNFTDQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.838 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.45E-31 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.9E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.6E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.5E-25 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.82E-12 | 17 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.465 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 2.1E-18 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.9E-18 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.51E-14 | 69 | 112 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.6E-27 | 69 | 116 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MRMTRDGKEQ EYKKGLWTVE EDKILMDYVR THGQGHWNRI AKKTGLKRCG KSCRLRWMNY 60 LSPTVNRGNF TDQEEDLIIR LHKLLGNRWS LIAKRVPGRT DNQVKNYWNT HLSKKLGLGD 120 HLSGAKPACD AESPPSLALI TTTSSNHQEI AGEKVSTVRL DTLIDESKLK PKPKPVHSLP 180 TDVEVATTVP NLFDTFWVLE DDFELSSLTM MDFTNGYCL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-28 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa11g057470.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519631 | 0.0 | AY519631.1 Arabidopsis thaliana MYB transcription factor (At5g40330) mRNA, complete cds. | |||
GenBank | BT025285 | 0.0 | BT025285.1 Arabidopsis thaliana At5g40330 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010441164.1 | 1e-164 | PREDICTED: transcription factor MYB23-like | ||||
Swissprot | Q96276 | 1e-149 | MYB23_ARATH; Transcription factor MYB23 | ||||
TrEMBL | R0F1W9 | 1e-153 | R0F1W9_9BRAS; Uncharacterized protein | ||||
STRING | XP_010441164.1 | 1e-163 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40330.1 | 1e-151 | myb domain protein 23 |
Publications ? help Back to Top | |||
---|---|---|---|
|