PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa11g038610.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 158aa MW: 16899.8 Da PI: 6.1171 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 188.3 | 5.3e-59 | 20 | 115 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplk+yl+kyre+ege Csa11g038610.1 20 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKIYLQKYREVEGE 114 89********************************************************************************************9 PP NF-YB 97 k 97 k Csa11g038610.1 115 K 115 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-56 | 15 | 126 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.79E-42 | 22 | 126 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.4E-28 | 25 | 89 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 6.5E-22 | 53 | 71 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 56 | 72 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 6.5E-22 | 72 | 90 | No hit | No description |
PRINTS | PR00615 | 6.5E-22 | 91 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MADSDNDSGG HKDGGNASTR EQDRFLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF 60 ISFITGEASD KCQREKRKTI NGDDLLWAMT TLGFEDYVEP LKIYLQKYRE VEGEKTTTAG 120 KQGDKEGGGA GGSGSGGAPM YGGGMVTMGH QFSHHFS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-50 | 14 | 110 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa11g038610.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK117818 | 0.0 | AK117818.1 Arabidopsis thaliana At4g14540 mRNA for putative CCAAT-binding transcription factor subunit A(CBF-A), complete cds, clone: RAFL18-01-N02. | |||
GenBank | AL161539 | 0.0 | AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39. | |||
GenBank | BT003684 | 0.0 | BT003684.1 Arabidopsis thaliana At4g14540 mRNA, complete cds. | |||
GenBank | CP002687 | 0.0 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. | |||
GenBank | Z97336 | 0.0 | Z97336.1 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 1. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010440452.1 | 1e-114 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 1e-101 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | R0H453 | 1e-100 | R0H453_9BRAS; Uncharacterized protein | ||||
STRING | XP_010440452.1 | 1e-114 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 4e-92 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|