PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g019070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 675aa    MW: 75967.8 Da    PI: 6.362
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g019070.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.71.1e-23146247199
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +
  Csa10g019070.1 146 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFL--RGE 236
                     88****************************9643..445569************************************************..449 PP

                     EE..EEEEE-S CS
              B3  89 efelvvkvfrk 99 
                     ++el+v+ +r+
  Csa10g019070.1 237 NGELRVGGRRA 247
                     9999***9987 PP

2Auxin_resp111.96.2e-37272351183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a ha++ k++F v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe+eds+err+sGtv+gv+d++p +W++SkWr+L+
  Csa10g019070.1 272 ACHATQAKTMFIVYYKPRT--SQFIISLNKYLEAMNNKFSVGMRFKMRFEGEDSPERRYSGTVIGVKDCSP-HWKDSKWRCLE 351
                     6799**************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.4E-38137275IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-41140261IPR015300DNA-binding pseudobarrel domain
CDDcd100173.95E-20144246No hitNo description
PfamPF023622.0E-21146247IPR003340B3 DNA binding domain
PROSITE profilePS5086312.111146248IPR003340B3 DNA binding domain
SMARTSM010191.8E-23146248IPR003340B3 DNA binding domain
PfamPF065075.6E-33272350IPR010525Auxin response factor
PfamPF023091.3E-12538647IPR033389AUX/IAA domain
SuperFamilySSF542779.81E-13554635No hitNo description
PROSITE profilePS5174525.81559651IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MTNQGGEGLY DELWKLCAGP LVDVPQAGER VYYFPQGEGL YDELWKLCAG PLVDVPQAEE  60
RVYYFPQGHM EQLEASTQQD LNTGKPFFDL PPKILCNVMN VRLQAEKDTD EVYAQITLIP  120
VGTKVDEPMS PDPSPPELQK PKVHSFSKVL TASDTSTHGG FSVLRKHATE CLPPLDMTQQ  180
TPTQELVAED VHGYQWKFKH IFRGQPRRHL LTTGWSTFVT SKRLVAGDTF VFLRGENGEL  240
RVGGRRANRQ QSSMPSSVIS SHSMHLGVLA TACHATQAKT MFIVYYKPRT SQFIISLNKY  300
LEAMNNKFSV GMRFKMRFEG EDSPERRYSG TVIGVKDCSP HWKDSKWRCL EVHWDEPASI  360
PRPDKVSPWE IEPFATSESV PQSVMLMKKR PRHTSEVSAL GETQSKAVIL ANVGITASNL  420
WQSHEFAQSC LTSQRSSSQQ CYRDSTEDAK KSDWLNNSYS VSNLSKDSTL NDQMVSPVEQ  480
KNSETTASYR LFGIDLMSSS LAASEEKSAP MRPINITKPT LDSNSDPKSE ISKVSEEKKQ  540
EPAQTSPKEV QSKQSSSTRS RTKVQMQGVP VGRAVDLTAL NGYNELIDDL EKLFDIKGEL  600
QSRNQWEIVF TDDEGDMMLV GDDPWPEFCN MVKRIFIWSK EEVKKMTPGN QLRMMLTEVE  660
TTLKTISKSD NHSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1613837417355Auxin response factor 1
4ldw_A1e-1613837417355Auxin response factor 1
4ldw_B1e-1613837417355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa10g019070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0821760.0AF082176.1 Arabidopsis thaliana auxin response factor 9 (ARF9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010433831.10.0PREDICTED: auxin response factor 9 isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A178V4030.0A0A178V403_ARATH; Auxin response factor
STRINGXP_010433832.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9