PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa10g003720.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 81aa MW: 9210.95 Da PI: 10.5325 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 69.3 | 3.6e-22 | 9 | 57 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k+ie+ +r+++f+kR+ng+lKKA+ELS LCd+ v ++ fs++gkl+ + Csa10g003720.1 9 KKIEDRQQRNISFAKRKNGLLKKAYELSLLCDVAVGLLFFSPSGKLFIF 57 68********************************************866 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 9.5E-28 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 25.287 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.88E-24 | 2 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-21 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.8E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-21 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-21 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 81 aa Download sequence Send to blast |
MGRVKIQMKK IEDRQQRNIS FAKRKNGLLK KAYELSLLCD VAVGLLFFSP SGKLFIFDAK 60 LSIEDIIDKY NSQPIHIIAR * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-17 | 1 | 74 | 1 | 75 | MEF2 CHIMERA |
6byy_B | 2e-17 | 1 | 74 | 1 | 75 | MEF2 CHIMERA |
6byy_C | 2e-17 | 1 | 74 | 1 | 75 | MEF2 CHIMERA |
6byy_D | 2e-17 | 1 | 74 | 1 | 75 | MEF2 CHIMERA |
6bz1_A | 2e-17 | 1 | 74 | 1 | 75 | MEF2 CHIMERA |
6bz1_B | 2e-17 | 1 | 74 | 1 | 75 | MEF2 CHIMERA |
6bz1_C | 2e-17 | 1 | 74 | 1 | 75 | MEF2 CHIMERA |
6bz1_D | 2e-17 | 1 | 74 | 1 | 75 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa10g003720.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010446661.1 | 8e-47 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
Swissprot | Q1PFC2 | 1e-22 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
TrEMBL | V4MKU5 | 9e-33 | V4MKU5_EUTSA; Uncharacterized protein | ||||
STRING | XP_010446661.1 | 3e-46 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77980.1 | 6e-25 | AGAMOUS-like 66 |
Publications ? help Back to Top | |||
---|---|---|---|
|