PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa09g071770.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 157aa MW: 18257.4 Da PI: 7.6054 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 29.5 | 1.3e-09 | 100 | 133 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++ ++ LA+++gL+++q+ +WF N+R ++ Csa09g071770.1 100 WPYPTEGDKIALAEETGLDQKQINNWFINQRKRH 133 69*****************************985 PP | |||||||
2 | ELK | 35 | 3.1e-12 | 53 | 74 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 +LK+qLlrK++++++sLk EFs Csa09g071770.1 53 DLKDQLLRKFGSHISSLKLEFS 74 6********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03789 | 2.8E-9 | 53 | 74 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 9.935 | 53 | 73 | IPR005539 | ELK domain |
SMART | SM01188 | 4.2E-6 | 53 | 74 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.698 | 73 | 136 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 3.98E-20 | 74 | 146 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 6.6E-13 | 75 | 140 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 6.2E-28 | 78 | 137 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 2.13E-11 | 82 | 137 | No hit | No description |
Pfam | PF05920 | 6.4E-18 | 93 | 132 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 111 | 134 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MLGKRYFRGS LKSLTKVTCV VAQVGSDDGA VSSDEELREA DDDESQQRNN DRDLKDQLLR 60 KFGSHISSLK LEFSKKKKKG KLPREARQAL LDWWNVHYRW PYPTEGDKIA LAEETGLDQK 120 QINNWFINQR KRHWKPSENM PFAMMDDSSD TFFTEE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa09g071770.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | X81353 | 1e-136 | X81353.1 A.thaliana mRNA for ATK1 protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010427829.1 | 5e-92 | PREDICTED: homeobox protein knotted-1-like 2 | ||||
Swissprot | P46640 | 3e-78 | KNAT2_ARATH; Homeobox protein knotted-1-like 2 | ||||
TrEMBL | A0A0D3APM9 | 8e-78 | A0A0D3APM9_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A398AAQ3 | 2e-77 | A0A398AAQ3_BRACM; Uncharacterized protein | ||||
TrEMBL | M4CUM5 | 2e-77 | M4CUM5_BRARP; Uncharacterized protein | ||||
STRING | XP_010427829.1 | 2e-91 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM835 | 27 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G70510.1 | 3e-72 | KNOTTED-like from Arabidopsis thaliana 2 |