PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa09g053640.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 111aa MW: 12609.8 Da PI: 5.6525 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 87.7 | 1.5e-27 | 4 | 100 | 3 | 99 |
DUF260 3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 +aCk r kC ++Cv+apy+pa++p+k+a + +F s++ ++l +++++ r++ ++sl+ Aear+rdPv G +g++l+lq+ql+ lk+el+ + Csa09g053640.1 4 CACKDVRHKCIEECVFAPYLPANNPEKYATLSTVFDISKLARYLMDIEPSLRQTCVDSLCLDAEARLRDPVMGITGLVLHLQRQLHDLKVELKIA 98 59******************************************************************************************998 PP DUF260 98 ke 99 k+ Csa09g053640.1 99 KR 100 75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 18.23 | 1 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.2E-27 | 5 | 99 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MELCACKDVR HKCIEECVFA PYLPANNPEK YATLSTVFDI SKLARYLMDI EPSLRQTCVD 60 SLCLDAEARL RDPVMGITGL VLHLQRQLHD LKVELKIAKR VLYDDFTIEP * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-24 | 5 | 98 | 14 | 107 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-24 | 5 | 98 | 14 | 107 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa09g053640.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019101899.1 | 9e-48 | PREDICTED: LOB domain-containing protein 6-like | ||||
TrEMBL | R0FR77 | 6e-40 | R0FR77_9BRAS; Uncharacterized protein | ||||
STRING | Bostr.6864s0195.1.p | 8e-51 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 1e-26 | LBD family protein |