PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa09g034120.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 210aa MW: 24181.2 Da PI: 8.6794 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 157 | 8.1e-49 | 57 | 183 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 + pGf+F+Ptd el+++yLk+k++g + ++ e+i+ev+iy++ePwdLp k++ ++++ew+fF+ r kky++g++++rat+ gyWkatgk+++v+s Csa09g034120.1 57 MFPGFKFSPTDIELISYYLKRKMDGLERSV-EIIPEVEIYNFEPWDLPdKSIVKSDSEWFFFCARGKKYPHGSQNRRATRMGYWKATGKERNVKS 150 579************************999.89***************778888899************************************** PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++e++g+k+tLvf+ grapkg +t+W+mhey + Csa09g034120.1 151 -GSEVIGTKRTLVFHIGRAPKGGRTEWIMHEYCM 183 .9******************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.59E-51 | 51 | 184 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 47.972 | 57 | 198 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.8E-25 | 59 | 182 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 210 aa Download sequence Send to blast |
CIVFFTSLVP IPETFFLFLF VTPQFLRSQR ERTLDPLSSL IFFYMAAAPV EPAVTTMFPG 60 FKFSPTDIEL ISYYLKRKMD GLERSVEIIP EVEIYNFEPW DLPDKSIVKS DSEWFFFCAR 120 GKKYPHGSQN RRATRMGYWK ATGKERNVKS GSEVIGTKRT LVFHIGRAPK GGRTEWIMHE 180 YCMIGVSLDI VMVIEYLKCY IGCSSYLPT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-40 | 44 | 184 | 3 | 143 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-40 | 44 | 184 | 3 | 143 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-40 | 44 | 184 | 3 | 143 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-40 | 44 | 184 | 3 | 143 | NO APICAL MERISTEM PROTEIN |
3swm_A | 7e-40 | 59 | 184 | 22 | 146 | NAC domain-containing protein 19 |
3swm_B | 7e-40 | 59 | 184 | 22 | 146 | NAC domain-containing protein 19 |
3swm_C | 7e-40 | 59 | 184 | 22 | 146 | NAC domain-containing protein 19 |
3swm_D | 7e-40 | 59 | 184 | 22 | 146 | NAC domain-containing protein 19 |
3swp_A | 7e-40 | 59 | 184 | 22 | 146 | NAC domain-containing protein 19 |
3swp_B | 7e-40 | 59 | 184 | 22 | 146 | NAC domain-containing protein 19 |
3swp_C | 7e-40 | 59 | 184 | 22 | 146 | NAC domain-containing protein 19 |
3swp_D | 7e-40 | 59 | 184 | 22 | 146 | NAC domain-containing protein 19 |
3ulx_A | 6e-40 | 53 | 183 | 11 | 140 | Stress-induced transcription factor NAC1 |
4dul_A | 5e-40 | 44 | 184 | 3 | 143 | NAC domain-containing protein 19 |
4dul_B | 5e-40 | 44 | 184 | 3 | 143 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcription factor involved in modulation of abscisic acid (ABA) signaling. Attenuates ABA sensitivity and glucose-induced ABA accumulation. Reduces the expression of ABI4 gene. {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:24625790}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa09g034120.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By glucose (PubMed:24625790). Induced by salt, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:24625790}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK352951 | 1e-153 | AK352951.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-19-C18. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010425846.1 | 1e-105 | PREDICTED: NAC domain-containing protein 60-like isoform X1 | ||||
Refseq | XP_010514768.1 | 1e-105 | PREDICTED: NAC domain-containing protein 60 | ||||
Swissprot | Q9LXL9 | 1e-102 | NAC60_ARATH; NAC domain-containing protein 60 | ||||
TrEMBL | R0HPC6 | 1e-101 | R0HPC6_9BRAS; Uncharacterized protein | ||||
STRING | XP_010425846.1 | 1e-105 | (Camelina sativa) | ||||
STRING | XP_010514768.1 | 1e-104 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4309 | 23 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G44290.1 | 1e-104 | NAC domain containing protein 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|