PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa08g056710.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 148aa MW: 17264.6 Da PI: 9.6372 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 184.7 | 2.2e-57 | 17 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdeel+++yL++kv + +++ ++i evd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ Csa08g056710.1 17 LPPGFRFHPTDEELITHYLHNKVLDMAFSA-KAIGEVDLNKAEPWELPYKAKMGEKEWYFFCVRDRKYPTGLRTNRATQAGYWKATGKDKEIYR- 109 79**************************99.88***************99999*****************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++lvg+kktLvfy+grapkg kt+Wvmheyrl Csa08g056710.1 110 GKSLVGMKKTLVFYRGRAPKGLKTNWVMHEYRL 142 999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.37E-61 | 13 | 145 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.831 | 17 | 147 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.6E-30 | 18 | 142 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MEAFGGFHKE DDEQMDLPPG FRFHPTDEEL ITHYLHNKVL DMAFSAKAIG EVDLNKAEPW 60 ELPYKAKMGE KEWYFFCVRD RKYPTGLRTN RATQAGYWKA TGKDKEIYRG KSLVGMKKTL 120 VFYRGRAPKG LKTNWVMHEY RLDGKXF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-53 | 14 | 142 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-53 | 14 | 142 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-53 | 14 | 142 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-53 | 14 | 142 | 14 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
3swm_B | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
3swm_C | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
3swm_D | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
3swp_A | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
3swp_B | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
3swp_C | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
3swp_D | 2e-53 | 14 | 142 | 17 | 145 | NAC domain-containing protein 19 |
4dul_A | 2e-53 | 14 | 142 | 14 | 142 | NAC domain-containing protein 19 |
4dul_B | 2e-53 | 14 | 142 | 14 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa08g056710.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK228027 | 0.0 | AK228027.1 Arabidopsis thaliana mRNA for no apical meristem (NAM) -like protein, complete cds, clone: RAFL14-54-D06. | |||
GenBank | BT006419 | 0.0 | BT006419.1 Arabidopsis thaliana At5g07680 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010423179.1 | 1e-106 | PREDICTED: NAC domain-containing protein 79 | ||||
Swissprot | Q9FLR3 | 1e-101 | NAC79_ARATH; NAC domain-containing protein 79 | ||||
TrEMBL | R0HBK3 | 1e-100 | R0HBK3_9BRAS; Uncharacterized protein | ||||
STRING | XP_010423179.1 | 1e-106 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM400 | 28 | 174 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G07680.1 | 1e-103 | NAC domain containing protein 80 |
Publications ? help Back to Top | |||
---|---|---|---|
|