PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa08g005750.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 263aa MW: 29652.5 Da PI: 8.4836 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.7 | 1.7e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien rqvtfskRr+g+lKKA+ELSvLCdaevavi+fs++gkl+e+ss Csa08g005750.1 9 KRIENANSRQVTFSKRRAGLLKKAHELSVLCDAEVAVIVFSKSGKLFEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 77.6 | 3.2e-26 | 72 | 170 | 1 | 100 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 yq+ss++ + e+ +e+ + e++ Lk+ei++Lq+++ +l+G++L+ L++keLq+LeqqL+++l ++R++K++ll q+ee++ ke++++ en++Lr Csa08g005750.1 72 YQSSSDS-KVENLQEEDCAEVDLLKDEISKLQKKHLQLQGKGLNILNFKELQNLEQQLHHALLSVRERKERLLAIQLEESRLKEQRAELENETLR 165 4544444.455557889****************************************************************************** PP K-box 96 kklee 100 ++++e Csa08g005750.1 166 RQVQE 170 **986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.7E-43 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.842 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.98E-33 | 2 | 75 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.49E-45 | 2 | 76 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.8E-17 | 83 | 168 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.337 | 84 | 174 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 263 aa Download sequence Send to blast |
MGRGKIEIKR IENANSRQVT FSKRRAGLLK KAHELSVLCD AEVAVIVFSK SGKLFEFSSS 60 GMKKTLSRYG NYQSSSDSKV ENLQEEDCAE VDLLKDEISK LQKKHLQLQG KGLNILNFKE 120 LQNLEQQLHH ALLSVRERKE RLLAIQLEES RLKEQRAELE NETLRRQVQE LRSFLPSFTH 180 YVPSYIKCFA IDPRNAVLNH GCLDDSNCSL QKTNSDTTLQ LGLPGDAHAH DRRKNEGDRE 240 SPSSDSVTTN TTTATADRIS LV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 1e-23 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
6bz1_B | 1e-23 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
6bz1_C | 1e-23 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
6bz1_D | 1e-23 | 1 | 83 | 1 | 83 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12226488, ECO:0000269|PubMed:12743119, ECO:0000269|PubMed:14615187, ECO:0000269|PubMed:15084721, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18305206, ECO:0000269|PubMed:19269998, ECO:0000269|PubMed:19767455, ECO:0000269|PubMed:8953767}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa08g005750.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin (2,4-D). Feedback loop leading to direct down-regulation by itself. {ECO:0000269|PubMed:15686521}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010419983.1 | 0.0 | PREDICTED: agamous-like MADS-box protein AGL15 isoform X1 | ||||
Swissprot | Q38847 | 1e-154 | AGL15_ARATH; Agamous-like MADS-box protein AGL15 | ||||
TrEMBL | R0FJ29 | 1e-171 | R0FJ29_9BRAS; Uncharacterized protein | ||||
STRING | XP_010419983.1 | 0.0 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7518 | 25 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13790.1 | 1e-137 | AGAMOUS-like 15 |