PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa08g002400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 365aa    MW: 40616.7 Da    PI: 4.42
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa08g002400.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.4e-08302349653
                     S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     + +k  +e+Le+++++++ p+ +    + + ++L+ ++V  WF  +Ra
  Csa08g002400.1 302 RVKKAHIETLEKVYRRSKRPTNAVVSSIVQVTNLPRKRVLKWFEDKRA 349
                     567899*****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.669294354IPR001356Homeobox domain
SuperFamilySSF466896.42E-8299354IPR009057Homeodomain-like
SMARTSM003897.8E-4300358IPR001356Homeobox domain
PfamPF000464.8E-6302349IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-7302360IPR009057Homeodomain-like
CDDcd000861.87E-5305349No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MAVALSSSSG VVSHLLPPSF SSSSRVSVNR VLFRNRKSSP CSLSLPFHSP SLRSVLVFAR  60
GKNRKGFASS SSPSPKKNKK KSFERDDNGE SEEEDDPFEA LFNLLEEDLK NDNSSIDDEE  120
ISEEELNALA DELARVLGGG DDDDDGIDLF GSATGDVVDD KDENEDEDDN NDDEDDEDEN  180
DDDSEEEDER PSKLKNWQLR RLAYALKAGR RKTSIKNLAA EVCLDRAYVL ELLRDPPPKL  240
LMLSATLPDE KPPVAAPENS SPDPTPVESS SAEEEDVVVE PVEKVKDEAV HVMQQRWSAQ  300
KRVKKAHIET LEKVYRRSKR PTNAVVSSIV QVTNLPRKRV LKWFEDKRAE DGVPDKRAPY  360
QAPV*
Functional Description ? help Back to Top
Source Description
UniProtMay modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity). Homeodomain transcription factor that mediates jasmonic acid (JA)-mediated COI1-dependent and abscisic acid (ABA)-mediated PMR4-dependent resistance to infection by necrotrophic fungal pathogens (e.g. B.cinerea and P.cucumerina) and bacterial pathogens (e.g. P.syringae DC3000); this resistance involves at least callose deposition (PubMed:15923348, PubMed:20836879, PubMed:21564353). Required for the P.fluorescens WCS417r-triggered JA-dependent induced systemic resistance (ISR) against both P.syringae DC3000 and H.arabidopsidis (PubMed:20836879). Negative regulator of the ABA-dependent drought resistance (PubMed:19175769). {ECO:0000250|UniProtKB:Q70Z19, ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769, ECO:0000269|PubMed:20836879, ECO:0000269|PubMed:21564353}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa08g002400.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Constitutively expressed in healthy plants but repressed in response to infection by necrotrophic fungi (PubMed:15923348). Repressed by drought and abscisic acid (ABA) (PubMed:19175769). {ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0020170.0BT002017.1 Arabidopsis thaliana putative protein (At5g11270) mRNA, complete cds.
GenBankBT0087430.0BT008743.1 Arabidopsis thaliana At5g11270 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010419685.10.0PREDICTED: protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3-like
SwissprotQ8H0V51e-159OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLD7M3N91e-173D7M3N9_ARALL; Uncharacterized protein
STRINGXP_010419685.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM120772631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.11e-119overexpressor of cationic peroxidase 3
Publications ? help Back to Top
  1. García-Andrade J,Ramírez V,López A,Vera P
    Mediated plastid RNA editing in plant immunity.
    PLoS Pathog., 2013. 9(10): p. e1003713
    [PMID:24204264]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gamir J,Pastor V,Kaever A,Cerezo M,Flors V
    Targeting novel chemical and constitutive primed metabolites against Plectosphaerella cucumerina.
    Plant J., 2014. 78(2): p. 227-40
    [PMID:24506441]