PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa08520s010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 143aa MW: 15490.3 Da PI: 6.5557 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 51.3 | 2.6e-16 | 88 | 141 | 4 | 57 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 +r+rr++kNRe+A rsR+RK+a++ eLe+ +++Le+eN+ L ke+e +ke + Csa08520s010.1 88 AQRQRRMIKNRESAARSRERKQAYQVELETLAAKLEEENELLSKEIEDKRKERY 141 79********************************************99888876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.9E-13 | 84 | 139 | No hit | No description |
SMART | SM00338 | 2.4E-6 | 85 | 143 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.0E-15 | 87 | 142 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.197 | 87 | 139 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.88E-10 | 89 | 140 | No hit | No description |
CDD | cd14707 | 1.16E-17 | 89 | 134 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 92 | 107 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
AAGEDEGGAA VTAEDLDVKI PPPTNYGFDH SAPPHNPFQM IDKVEGSIVA FGNGLDVFGG 60 GGGGVGAGGG ARGKRARVMV EPLDKVAAQR QRRMIKNRES AARSRERKQA YQVELETLAA 120 KLEEENELLS KEIEDKRKER YQK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa08520s010.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY086457 | 1e-104 | AY086457.1 Arabidopsis thaliana clone 25211 mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010497677.2 | 7e-98 | PREDICTED: G-box-binding factor 4-like, partial | ||||
Swissprot | P42777 | 2e-38 | GBF4_ARATH; G-box-binding factor 4 | ||||
TrEMBL | A0A178UQ19 | 6e-76 | A0A178UQ19_ARATH; Uncharacterized protein | ||||
TrEMBL | Q8LCQ7 | 6e-76 | Q8LCQ7_ARATH; Uncharacterized protein | ||||
STRING | XP_010494407.1 | 3e-82 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3852 | 28 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G44080.1 | 9e-46 | bZIP family protein |