PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa07g048440.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 103aa MW: 10567.7 Da PI: 4.3022 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 28.7 | 3.4e-09 | 70 | 102 | 1 | 33 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWee 33 rW++qe+laL+++r++m+ ++r+++ k+plWee Csa07g048440.1 70 RWPRQETLALLKLRSDMGIAFRDASVKGPLWEE 102 8******************************97 PP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MMQLGGGTPS TTTTTTAAAA STATPPPPPP QPQPQPQSND SAATEAAAAA AVGAFEVSEE 60 MNDRGFGGNR WPRQETLALL KLRSDMGIAF RDASVKGPLW EE* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa07g048440.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC079283 | 7e-66 | AC079283.4 Arabidopsis thaliana chromosome 1 BAC F7O12 genomic sequence, complete sequence. | |||
GenBank | CP002684 | 7e-66 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010416611.1 | 1e-63 | PREDICTED: trihelix transcription factor GT-2-like isoform X1 | ||||
Refseq | XP_019083408.1 | 1e-63 | PREDICTED: trihelix transcription factor GT-2-like isoform X2 | ||||
TrEMBL | M4CHM0 | 2e-28 | M4CHM0_BRARP; Uncharacterized protein | ||||
STRING | XP_010416611.1 | 5e-63 | (Camelina sativa) | ||||
STRING | XP_010416612.1 | 1e-66 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM32324 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76880.1 | 7e-28 | Trihelix family protein |