PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g002790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 597aa    MW: 67058.3 Da    PI: 7.584
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g002790.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.61.2e-23129229198
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv+a++L +gD +vF   + +
  Csa07g002790.1 129 FVKILTASDTSTHGGFSVLRKHATEClpaldmtQ--ATPTQELVTRDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVSAKRLVAGDAFVFL--RGE 219
                     89****************************9543..445569************************************************..348 PP

                     EE..EEEEE- CS
              B3  89 efelvvkvfr 98 
                     ++ l+v+v+r
  Csa07g002790.1 220 NGDLRVGVRR 229
                     8889***998 PP

2Auxin_resp91.71.2e-30255334183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha+ +k++F v+Y+Pr   s+F+v v+k+++a+k+ + +G+Rf+m+fe+e+s+e+ ++Gt+vg+ dl++ +Wp SkWrsL+
  Csa07g002790.1 255 ASHAVGSKTMFVVFYKPRI--SQFIVGVNKYLEAIKHGFPLGTRFRMRFEGEESPEKIFTGTIVGTGDLSS-EWPASKWRSLQ 334
                     6899**************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.62E-40114258IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-38122244IPR015300DNA-binding pseudobarrel domain
CDDcd100174.14E-20127229No hitNo description
SMARTSM010193.7E-21129231IPR003340B3 DNA binding domain
PfamPF023621.0E-21129229IPR003340B3 DNA binding domain
PROSITE profilePS5086312.139129231IPR003340B3 DNA binding domain
PfamPF065073.7E-28255334IPR010525Auxin response factor
PfamPF023099.4E-8485529IPR033389AUX/IAA domain
SuperFamilySSF542773.99E-13492569No hitNo description
PROSITE profilePS5174526.474493585IPR000270PB1 domain
PfamPF023091.1E-5539578IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MASVEGDDDF RTSLSRSYQD QLYTELWKAC AGPLVEVPRA EERVFYFPQG HMEQLVASTN  60
QGIKSEEIPK FNLPPKKILC RVLNVTLKAE HETDEVYAQI TLKPEEHQIE PTSLDPPLVE  120
PAKQMFHSFV KILTASDTST HGGFSVLRKH ATECLPALDM TQATPTQELV TRDLHGFEWR  180
FKHIFRGQPR RHLLTTGWST FVSAKRLVAG DAFVFLRGEN GDLRVGVRRL ARHQSTMPTS  240
VISSQSMHLG VLATASHAVG SKTMFVVFYK PRISQFIVGV NKYLEAIKHG FPLGTRFRMR  300
FEGEESPEKI FTGTIVGTGD LSSEWPASKW RSLQVQWDEP TTVQRPDKVS PWEIEPFLPT  360
SPITTPAQQP QSKCKRSRPI EPSVITPSPP SFLYSFPQSQ DPANTSLQLF QDPSLERSSG  420
GYSSNNSFLA ETPPPPPPPT NGCYRLFGFD LTSNPTAPIL PDKQPNDTCG AAKCQEPITP  480
TSMNEQKKQQ TSRSRTKVQM QGIAVGRAVD LTLLKSYDEL IKELERMFEI QGQLRPRDKW  540
VVVFTDDEGD MMLAGDDPWN EFCKMAKKIF IYSSDEVKKM TTKRKLSSSL EGLDVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1602035717355Auxin response factor 1
4ldw_A1e-1602035717355Auxin response factor 1
4ldw_B1e-1602035717355Auxin response factor 1
4ldx_A1e-1602035717355Auxin response factor 1
4ldx_B1e-1602035717355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa07g002790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3347170.0AF334717.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0597460.0AY059746.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0704630.0AY070463.1 Arabidopsis thaliana AT3g61830/F15G16_220 mRNA, complete cds.
GenBankAY0913920.0AY091392.1 Arabidopsis thaliana putative auxin response factor protein (At3g61830) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010413341.10.0PREDICTED: auxin response factor 18-like
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLR0FT390.0R0FT39_9BRAS; Auxin response factor
STRINGXP_010413341.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]