PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa06g039740.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 114aa MW: 12883.7 Da PI: 8.7198 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 176.5 | 2.6e-55 | 23 | 114 | 1 | 92 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 vreqdrflPian+srimk+ lPan+ki+kdake+vqecvsefisf+tseasdkcqrekrktingddllwa+atlGfe+y+eplk+yl++yre Csa06g039740.1 23 VREQDRFLPIANISRIMKRGLPANGKIAKDAKEIVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKLYLMRYRE 114 69*****************************************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.2E-50 | 21 | 114 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.32E-38 | 26 | 114 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.3E-28 | 29 | 93 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.5E-21 | 57 | 75 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 60 | 76 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.5E-21 | 76 | 94 | No hit | No description |
PRINTS | PR00615 | 1.5E-21 | 95 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
AKSPGGGGRH ESGGDQSPRS LHVREQDRFL PIANISRIMK RGLPANGKIA KDAKEIVQEC 60 VSEFISFITS EASDKCQREK RKTINGDDLL WAMATLGFEE YIEPLKLYLM RYRE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 5e-48 | 21 | 114 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 5e-48 | 21 | 114 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa06g039740.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK317223 | 1e-137 | AK317223.1 Arabidopsis thaliana AT2G37060 mRNA, partial cds, clone: RAFL22-38-O10. | |||
GenBank | AY070477 | 1e-137 | AY070477.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds. | |||
GenBank | AY091673 | 1e-137 | AY091673.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010509397.1 | 1e-80 | PREDICTED: nuclear transcription factor Y subunit B-8 | ||||
Refseq | XP_010509398.1 | 1e-80 | PREDICTED: nuclear transcription factor Y subunit B-8 | ||||
Refseq | XP_010516951.1 | 1e-80 | PREDICTED: nuclear transcription factor Y subunit B-8 | ||||
Refseq | XP_019101277.1 | 1e-80 | PREDICTED: nuclear transcription factor Y subunit B-8 | ||||
Swissprot | Q8VYK4 | 4e-78 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | R0HVN6 | 1e-77 | R0HVN6_9BRAS; Uncharacterized protein (Fragment) | ||||
STRING | XP_010509397.1 | 4e-80 | (Camelina sativa) | ||||
STRING | XP_010516951.1 | 4e-80 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1480 | 27 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 2e-73 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|