PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa06g028820.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 296aa MW: 34997.2 Da PI: 9.9363 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.6 | 8.8e-30 | 72 | 122 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvt+skRrng++KKA+EL vLCda+v++i+fss++kl+ey+s Csa06g028820.1 72 KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYIS 122 79***********************************************86 PP | |||||||
2 | K-box | 77.6 | 3.2e-26 | 134 | 232 | 1 | 99 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 yq+ s+++++++++e++q+ +kL + ++nL+++++++lGe+Le+L++ eL++Le+++e+ k +R++K + l +qie+++kk+k++q+++k+L Csa06g028820.1 134 YQSISDVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLEELDYHELRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDIQKNLI 228 78899999**************************************************************************************9 PP K-box 96 kkle 99 ++le Csa06g028820.1 229 HELE 232 9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.142 | 64 | 124 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.0E-40 | 64 | 123 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.02E-39 | 65 | 143 | No hit | No description |
SuperFamily | SSF55455 | 6.93E-36 | 66 | 157 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 66 | 120 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-28 | 66 | 86 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.5E-25 | 73 | 120 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-28 | 86 | 101 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-28 | 101 | 122 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.1E-14 | 145 | 231 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.607 | 147 | 237 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 296 aa Download sequence Send to blast |
LFIVTQVDPL LLQLYLSLSI SFLFFLKKFY FISFFLLYLF VLSPPNLFSK RFKTKVEKKK 60 KKNMARGKIQ IKRIENQTNR QVTYSKRRNG LFKKAHELTV LCDARVSIIM FSSSNKLHEY 120 ISPNTTTKEI VDLYQSISDV DVWSTQYERM QETKRKLLET NRNLRTQIKQ RLGECLEELD 180 YHELRRLEDE MENTFKLVRE RKIKSLGNQI ETTKKKNKSQ QDIQKNLIHE LELRAEDPHY 240 GLVDNGGDYD SVLGYQIEGS RAYALRYHQN HHHHYPNHAL HAPSASDIIT FHLLE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 3e-17 | 64 | 124 | 1 | 61 | MEF2 CHIMERA |
6byy_B | 3e-17 | 64 | 124 | 1 | 61 | MEF2 CHIMERA |
6byy_C | 3e-17 | 64 | 124 | 1 | 61 | MEF2 CHIMERA |
6byy_D | 3e-17 | 64 | 124 | 1 | 61 | MEF2 CHIMERA |
6bz1_A | 3e-17 | 64 | 124 | 1 | 61 | MEF2 CHIMERA |
6bz1_B | 3e-17 | 64 | 124 | 1 | 61 | MEF2 CHIMERA |
6bz1_C | 3e-17 | 64 | 124 | 1 | 61 | MEF2 CHIMERA |
6bz1_D | 3e-17 | 64 | 124 | 1 | 61 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269|PubMed:18417639, ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9489703}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00077 | ChIP-seq | Transfer from AT3G54340 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa06g028820.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269|PubMed:11283333, ECO:0000269|PubMed:19783648}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU551764 | 0.0 | EU551764.1 Capsella bursa-pastoris APETALA3-like protein (AP3a) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010515958.1 | 1e-173 | PREDICTED: floral homeotic protein APETALA 3 | ||||
Swissprot | P35632 | 1e-167 | AP3_ARATH; Floral homeotic protein APETALA 3 | ||||
TrEMBL | A0A1J3IMM1 | 1e-171 | A0A1J3IMM1_NOCCA; Floral homeotic protein APETALA 3 (Fragment) | ||||
STRING | XP_010515958.1 | 1e-172 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5261 | 27 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54340.1 | 1e-151 | MIKC_MADS family protein |