PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g094000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 592aa    MW: 66668.7 Da    PI: 7.3562
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g094000.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3733.5e-23128228198
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv++++L +gD +vF   + +
  Csa05g094000.1 128 FVKILTASDTSTHGGFSVLRKHATEClpaldmtQ--ATPTQELVTRDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDAFVFL--RGE 218
                     89****************************9543..445569************************************************..348 PP

                     EE..EEEEE- CS
              B3  89 efelvvkvfr 98 
                     ++ l+v+v+r
  Csa05g094000.1 219 NGDLRVGVRR 228
                     8889***998 PP

2Auxin_resp95.58.3e-32254333183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha+ +k++F v+Y+Pr   s+F+v v+k+++a+k+ +s+G+Rf+m+fe+e+s+er ++Gt+vg+ dl++ +Wp SkWrsL+
  Csa05g094000.1 254 ASHAVGSKTMFVVFYKPRI--SQFIVGVNKYMEAIKHGFSLGTRFRMRFEGEESPERIFTGTIVGTGDLSS-EWPASKWRSLQ 333
                     6899**************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.53E-40113257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.2E-38121243IPR015300DNA-binding pseudobarrel domain
CDDcd100179.28E-20126228No hitNo description
PfamPF023623.1E-21128228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.083128230IPR003340B3 DNA binding domain
SMARTSM010191.3E-20128230IPR003340B3 DNA binding domain
PfamPF065073.7E-29254333IPR010525Auxin response factor
PfamPF023099.3E-8482526IPR033389AUX/IAA domain
SuperFamilySSF542773.92E-13489566No hitNo description
PROSITE profilePS5174526.474490582IPR000270PB1 domain
PfamPF023091.1E-5536575IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MASVEGDDDF RTSLSRSYQD QLYTELWKAC AGPLVEVPRA EERVFYFPQG HMEQLVASTN  60
QGIKSEEIPK FNLPPKILCR VLNVTLKAEH ETDEVYAQIT LKPEEHQIEP TSLDPPLVEP  120
AKQMFHSFVK ILTASDTSTH GGFSVLRKHA TECLPALDMT QATPTQELVT RDLHGFEWRF  180
KHIFRGQPRR HLLTTGWSTF VSSKRLVAGD AFVFLRGENG DLRVGVRRLA RHQSTMPTSV  240
ISSQSMHLGV LATASHAVGS KTMFVVFYKP RISQFIVGVN KYMEAIKHGF SLGTRFRMRF  300
EGEESPERIF TGTIVGTGDL SSEWPASKWR SLQVQWDEPT TVQRPDKVSP WEIEPFLPTS  360
PISTPAQQPQ PQSKCKRSRP MEPSVTTPAP PSFLYSFPQS QDPANTSLKL FQDPSLERSS  420
GGYSSNNSLI AETPPPTNGC YRLFGFDLTS NPTAPIFPDK QPNDTCGAAK CQEPITPTSM  480
NEQKKQQTSR SRTKVQMQGI AVGRAVDLTL LKSYDELIKE LERMFEIQGQ LRPRDKWVVV  540
FTDDEGDMML AGDDPWNEFC KMAKKIFIYS SDEVKKMTTK RKLSSSLENE E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1622035617355Auxin response factor 1
4ldw_A1e-1622035617355Auxin response factor 1
4ldw_B1e-1622035617355Auxin response factor 1
4ldx_A1e-1622035617355Auxin response factor 1
4ldx_B1e-1622035617355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCsa05g094000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3347170.0AF334717.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0597460.0AY059746.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0704630.0AY070463.1 Arabidopsis thaliana AT3g61830/F15G16_220 mRNA, complete cds.
GenBankAY0913920.0AY091392.1 Arabidopsis thaliana putative auxin response factor protein (At3g61830) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010512556.10.0PREDICTED: auxin response factor 18
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLR0FT390.0R0FT39_9BRAS; Auxin response factor
STRINGXP_010512556.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]